KEGG   Leclercia sp. W17: DVA44_08390Help
Entry
DVA44_08390       CDS       T05987                                 

Definition
(GenBank) cystine ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
lee  Leclercia sp. W17
Pathway
lee02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lee00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DVA44_08390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lee02000]
    DVA44_08390
   02035 Bacterial motility proteins [BR:lee02035]
    DVA44_08390
Transporters [BR:lee02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    DVA44_08390
Bacterial motility proteins [BR:lee02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    DVA44_08390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AXF64140
UniProt: A0A345C8N5
LinkDB All DBs
Position
1724900..1725700
Genome map
AA seq 266 aa AA seqDB search
MKFALLGRQALMGVMAVALVAGMSVKTFAAEGLLNKVKERGTLLVGLEGTYPPFSFQGDD
GKLTGFEVEFAEELAKHLGVKASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDF
STPYTVSGIQALVKKGNEGSIKSAADLKDKKVGVGLGTNYEEWLRQNVQGVDIRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTNNTLAVAGDAFSRQEAGVAIRKGNEDLVKAVD
GAIAEMQKDGSLKALSEKWFGADVTK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcacttctgggtcgtcaggcgctgatgggtgtaatggccgttgcgctggtt
gcgggtatgagcgtcaagaccttcgccgcagagggtcttttaaacaaagttaaagagcgc
ggcacgctgctggttgggctggaagggacctaccctccgttcagcttccagggtgacgac
ggtaaactgaccggttttgaggtggagtttgccgaagagctggcaaaacacctcggtgtg
aaagcctcgctgaagccgaccaaatgggacggcatgctggcgtcgctggactcaaaacgt
attgatgtggtgattaaccaggtcaccatctctgacgaacgtaagaaaaagtatgacttc
tccaccccgtataccgtctccggtatccaggcgctggtgaaaaaaggtaacgaaggctcc
attaaatctgctgccgacctgaaagataaaaaagtgggcgtcggtctggggaccaactac
gaagagtggctgcgccagaacgtgcagggtgttgatatccgcacctatgatgacgacccg
accaaataccaggatctgcgcgtaggccgtattgatgccattctggttgaccgcctggcg
gcgctggatctggtgaagaaaaccaacaacaccctggccgttgccggtgatgccttctcc
cgtcaggaagcgggcgttgcgatccgcaaaggcaacgaggatctggtcaaagcagttgac
ggcgccattgccgagatgcagaaagacggcagcctgaaggcgctctccgaaaaatggttc
ggggcagacgtcacaaagtaa

DBGET integrated database retrieval system