KEGG   Leclercia sp. W17: DVA44_12640Help
Entry
DVA44_12640       CDS       T05987                                 

Definition
(GenBank) Zn-dependent oxidoreductase
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
lee  Leclercia sp. W17
Pathway
lee00040  Pentose and glucuronate interconversions
lee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DVA44_12640
Enzymes [BR:lee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     DVA44_12640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 Shikimate_DH NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AXF64889
UniProt: A0A345CAT4
LinkDB All DBs
Position
complement(2591073..2592089)
Genome map
AA seq 338 aa AA seqDB search
MKSIVIQQPNSLVIEERSLPAPAPGEVCVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHE
FFGVIDAVGEGVDTARLGQRVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEY
AVVPAKNAWVIPDAVSDEHAVMVEPFTIAANVTGHASPTEQDVALIYGAGPMGLVTVQAL
KGVYKVKQVIVVDRIDERLAMAQRSGADWVINNGNQSLQAVLEEKGIKPTLIIDAACHPS
ILQEAVNLASPGARIVLMGFSSEPSQVAQQGITGKELSIFSSRLNANKFPVVIDWLEKGL
IDPDKLITHRFEYQDVKDAIELFEKDQRQCCKVLLTFS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtatcgttattcaacaaccgaattcgctggtgatcgaagagcgttcgctaccc
gcgcctgcaccaggcgaagtgtgcgtcaaagtgaagctggccgggatctgcggttccgac
agccatatctatcgcggccacaacccgttcgccaaatatccccgtgtgatcggccatgag
ttctttggcgtcatcgatgccgtcggcgagggcgtcgacaccgcacgcctgggccagcgc
gtctcggttgacccggtgatcagctgcggccactgctacccgtgctcggtcggcaaaccg
aacgtctgcacctctctggtggtactgggcgtgcatcgtgacggcggcttcagcgaatac
gccgtggtacccgcaaaaaatgcctgggtcattccggatgccgtcagcgatgaacatgcg
gtgatggttgagccattcaccatcgcggccaacgtcaccggccacgccagcccgacagag
caggatgtggcgctcatttacggcgccggcccgatggggctggtcaccgtccaggcgctg
aagggcgtctacaaggtgaaacaggtcattgtggtcgatcgcatcgacgagcgtctggcg
atggcccagcgcagcggggcggactgggtcatcaacaacggcaaccagtctctgcaggcg
gtgctggaagagaagggcattaaaccgacgctgattattgatgcggcctgtcacccttct
attttgcaggaggctgtcaatctggcttcgccgggcgcgcgcattgtgctcatgggcttc
tccagcgaaccgagccaggttgcgcagcaggggatcaccggtaaagagctttccattttc
tcgtcacgtctgaacgccaataaattcccggtggtcatcgactggctggagaaagggctt
atcgaccctgacaaactgattactcatcgctttgagtatcaagacgttaaagacgctatt
gaactgtttgagaaagaccagcggcagtgctgcaaggtattactgacgttctcttaa

DBGET integrated database retrieval system