KEGG   Leclercia sp. W17: DVA44_17630Help
Entry
DVA44_17630       CDS       T05987                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lee  Leclercia sp. W17
Brite
KEGG Orthology (KO) [BR:lee00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DVA44_17630
Enzymes [BR:lee01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DVA44_17630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 Thi4 FAD_binding_3 K_oxygenase Glutaredoxin AlaDh_PNT_C DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: AXF65784
UniProt: A0A345CDC9
LinkDB All DBs
Position
complement(3548442..3550007)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIADLSEKVTFKEDNALAV
RKPSFLITNPGSTQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEALALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGVFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLAEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGQKLAGALKAHVSEYEVDVIDSQSASKLVPAAQEG
GFHEIETASGAVLKARSVIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLNNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDHLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcaaagcctaccttgagaagctgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgctg
gcggaaattgccgacctgtccgaaaaggtcacttttaaggaagataacgcgcttgcggtg
cgtaaaccctctttcctgatcaccaacccaggttcaacccaggggccgcgctttgccggt
tctccgctgggacacgaatttacctcactggtgctggccctgctgtggaccggcggtcat
ccgtcgaaagaggccctggcgctgcttgagcagatccgcgacctcgacggggattttgag
tttgaaacttactactcgctctcctgccataactgcccggacgtagtgcaggcgctgaac
ctgatggcggtgctgaacccgcgcatcaaacacaccgccatcgacggtggggtgttccag
aacgaaatcaccgatcgtaacgtgatgggcgttccggcggtatttgtgaacggtaaagag
tttggtcagggtcgtatgacgctggctgaaatcgtcgctaaagtggataccggcgctgaa
aaacgtgcggcagaagagctgaacaagcgtgatgcctatgatgtgctgatcgtcggttcc
ggccctgcgggtgcggcggctgcggtttactctgcccgtaaaggtattcgcaccggtctg
atgggcgaacgctttggcggccagatactggatacagtagatattgaaaactacatctcc
gtacctaaaaccgaaggtcagaaactggctggcgccctgaaagcgcacgtcagcgaatat
gaagtggatgtgatcgacagccagagcgccagcaaactggtgcctgcggcgcaggaaggc
ggcttccacgagattgagacagcgtctggtgcggtgctgaaagcgcgcagcgtcatcatt
gccaccggtgcgaaatggcgcaacatgaacgtgcctggcgaagagcagtatcgcaccaaa
ggggtgacctactgcccacactgcgacggcccgctgtttaaaggcaaacgcgtggcggta
attggtggcggtaactccggtgtggaagcggccatcgacctcgccggtatcgtggagcac
gttacgctgctggagtttgcgccggagatgaaagccgatcaggttctgcaggataaagtg
cgcagcctgaacaacgtcgacatcatcctgaacgcccagaccactgaagtgaaaggtgac
ggtagcaaagtgaccggtcttgagtaccgcgaccgcgtgagcggcgatgtgcacagcgtc
gcattggccgggatcttcgttcagattggtctgctgccgaacactacctggctggaaggc
gccattgagcgtaaccgcatgggcgagatcatcatcgacgccaagtgtgaaaccagcgtg
aagggcgtatttgcggcgggcgactgcaccaccgtaccgtacaagcagatcatcatcgcc
accggcgaaggggcgaaagcgtcactgagcgcctttgatcatctgattcgtaccaaaaca
gcataa

DBGET integrated database retrieval system