KEGG   Lelliottia jeotgali: LJPFL01_1191Help
Entry
LJPFL01_1191      CDS       T05035                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lef  Lelliottia jeotgali
Brite
KEGG Orthology (KO) [BR:lef00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LJPFL01_1191
Enzymes [BR:lef01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LJPFL01_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 Thi4 FAD_binding_3 Glutaredoxin K_oxygenase AlaDh_PNT_C DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: ASV54554
LinkDB All DBs
Position
1289309..1290874
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNTLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQISQIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGVFQNEITDRNVMGVPAVYVNGKE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDVYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYEVDVIDSQSASKLVPAAQEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GTKVTGLEYRDRVSGDVHSVPLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagttgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgctg
gcggaaatcgctgaactgtcaccgaaagtgacctttaaagaagacaatacgctggcggtg
cgcaagccgtcatttttgattaccaatccgggttctgaccaggggccgcgctttgctggc
tctccgctgggccatgagtttacttctctggtgctggcgctgctgtggaccggtggacat
ccgtcgaaagaagcgcagtctttgcttgagcagataagccaaatcgacggtgattttgag
ttcgaaacctactattcgctctcgtgccacaactgtccggacgtggtgcaggccctgaac
ctgatgtcggtgcttaacccgcgtatcaaacacacggccatcgacggcggcgtattccag
aatgaaatcaccgatcgcaacgtgatgggcgttccggcggtttatgtgaacggtaaagag
ttcggccaggggcgaatgacgctgaccgaaatcgtagccaaaatcgataccggcgcggag
aaacgtgcggcagaagagcttaacaaacgtgacgtgtacgacgtgctgattgtcggctcc
ggcccggcgggtgcggcagcggctgtttactcggcgcgtaaagggattcgtaccggcctg
atgggcgagcgttttggtggtcaggtgctcgacaccgtggatatcgaaaactacatctcc
gtgccaaaaaccgaaggtcaaaaactggcgggcgcactgaaagcgcacgttagcgattat
gaagtggacgtgatcgacagccagagtgccagcaaactggttccggcggcgcaggaaggt
ggcttacatcagattgaaaccgcctccggcgcggtgctgaaagcgcgcagcgtgatcatt
gccaccggcgcgaaatggcgcaacatgaacgtgccgggtgaagatcagtaccgcaccaaa
ggcgtgacctactgcccgcactgcgatggcccgctgtttaaaggtaagcgcgtcgcagtg
atcggcggtggtaactccggcgtggaagccgccatcgatctggccggcattgtggaacac
gtaacgctgctggaatttgcaccagaaatgaaagccgaccaggtattgcaggataaagtg
cgcagcctgaagaacgtcgatattgtgctgaacgcacagacgacggaagtgaaaggcgat
ggcactaaagtgaccggcctggaataccgcgaccgcgtgagcggtgacgttcacagcgtg
ccgctgtcagggattttcgtgcagattggtttgttgccaaacaccacctggctggaaggc
gccattgagcgcaaccgtatgggcgaaatcatcatcgacgccaaatgcgaaaccagcgtg
aagggcgtgtttgcggcgggcgactgcaccacggtgccgtacaagcagattatcatcgcc
accggcgaaggggcgaaagcgtcattaagctcatttgattatctcattcgcaccaaaaca
gcataa

DBGET integrated database retrieval system