KEGG   Lelliottia jeotgali: LJPFL01_1631Help
Entry
LJPFL01_1631      CDS       T05035                                 

Definition
(GenBank) beta-ketoacyl-(acyl-carrier-protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
lef  Lelliottia jeotgali
Pathway
lef00061  Fatty acid biosynthesis
lef00780  Biotin metabolism
lef01100  Metabolic pathways
lef01212  Fatty acid metabolism
Module
lef_M00083  Fatty acid biosynthesis, elongation
lef_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lef00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LJPFL01_1631
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LJPFL01_1631
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lef01004]
    LJPFL01_1631
Enzymes [BR:lef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     LJPFL01_1631
Lipid biosynthesis proteins [BR:lef01004]
 Fatty acid synthase
  Component type
   LJPFL01_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ASV54994
LinkDB All DBs
Position
1770996..1772201
Genome map
AA seq 401 aa AA seqDB search
MLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEEIISRKEQRKMD
AFIQYGIVAGWQAMQDSGLVITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISP
FFVPSTIVNMVAGHLTIMFGLRGPSISIATACTSGVHNIGQAARIIAYGDADAMVAGGAE
KASTPLGVGGFGAARALSTRNENPQAASRPWDKDRDGFVLGDGAGMIVLEEYEHAKKRGA
KIYAEIIGFGMSSDAYHMTSPPEDGAGAALAMVNAIRDAGIEPGQIGYVNAHGTSTPAGD
KAEAQAVKSVFGDAASRIMVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNP
DEGCDLDFVPHEARQVSGLEYTLCNSFGFGGTNGSLIFKKI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctcctgtcggcaataccgtagagtccacctggaaagctctccttgccggtcag
agcggcatcagcctaatcgaccatttcgatactagcgcctatgcaacgaaatttgctggc
ttagtaaaggattttaactgtgaagagattatctcgcgcaaagaacagcgcaagatggac
gccttcattcaatatggaattgttgcaggctggcaggccatgcaggattctggcctggta
attacggaagagaacgcaacccgcattggcgccgctatcggctccgggattggtggtctt
ggtctgatcgaggaaaaccacacatctttgatgaatggtggcccgcgtaagatcagcccg
ttcttcgttccgtccacgattgttaacatggtggcaggtcatttgaccatcatgttcggc
ctgcgtggcccaagcatttctatcgcaacggcttgtacctctggtgtgcataacatcggt
caggctgcgcgtatcatcgcttacggtgatgcagatgctatggttgccggtggtgctgaa
aaagccagtactccgctaggcgtgggtggtttcggtgcagcgcgcgcgctgtctacccgc
aacgagaatcctcaggcggcaagccgtccgtgggacaaagaccgtgatggttttgttctg
ggcgatggtgctggcatgatcgtactggaagagtacgaacacgcgaaaaagcgtggcgct
aaaatttatgcagaaattatcggtttcggcatgagcagcgacgcttaccacatgacgtct
ccaccggaagatggtgcgggtgcggcactggcaatggttaacgcgatccgcgatgcgggt
atcgaaccaggtcagattggctatgttaacgcccacggcacctcgacgccggctggcgac
aaagcagaagctcaggccgtcaaatccgtatttggtgatgcagcaagccgtattatggtg
agctccaccaaatccatgactggccacctgctgggtgcagcaggcgcagtagagtccatc
tactcgatccttgcactgcgcgatcaggctgttccgccaaccatcaacctggataacccg
gatgaaggttgtgatctggacttcgttccacacgaagcgcgtcaggttagcggtctggag
tacaccctgtgtaactccttcggcttcggcggcactaacggctctctgatctttaaaaag
atctaa

DBGET integrated database retrieval system