KEGG   Lelliottia jeotgali: LJPFL01_1751Help
Entry
LJPFL01_1751      CDS       T05035                                 

Definition
(GenBank) 6-phosphofructokinase class II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
lef  Lelliottia jeotgali
Pathway
lef00010  Glycolysis / Gluconeogenesis
lef00030  Pentose phosphate pathway
lef00051  Fructose and mannose metabolism
lef00052  Galactose metabolism
lef00680  Methane metabolism
lef01100  Metabolic pathways
lef01110  Biosynthesis of secondary metabolites
lef01120  Microbial metabolism in diverse environments
lef01130  Biosynthesis of antibiotics
lef01200  Carbon metabolism
lef01230  Biosynthesis of amino acids
Module
lef_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJPFL01_1751
   00030 Pentose phosphate pathway
    LJPFL01_1751
   00051 Fructose and mannose metabolism
    LJPFL01_1751
   00052 Galactose metabolism
    LJPFL01_1751
  09102 Energy metabolism
   00680 Methane metabolism
    LJPFL01_1751
Enzymes [BR:lef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LJPFL01_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase DUF2617
Motif
Other DBs
NCBI-ProteinID: ASV55114
LinkDB All DBs
Position
complement(1897193..1898125)
Genome map
AA seq 310 aa AA seqDB search
MVPIYTLTLSPSLDSATLTPQIYPEGKLRCSAPVFEPGGGGINVARAITHLGGTATAIFP
AGGATGEHLVALLANEHVAVDTVEAKDWTRQNLHVHVESSGEQYRFVMPGAMLEDNEFRQ
LEEKVLAIESGAILVISGSLPPGVKCEKLTHLIDAAKKKGLRCIVDSSGEALTAALESGN
LELIKPNQKELSALVNRPLTQPDDVRSAAEELVRNGKARRVVVSLGPQGALGVDETGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLKLAQGASLLEMTRYGVAAGSAATINHGTRLCSLEDT
QKIVDYLTRS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtaccgatttatacgctgacgctctccccttctctcgacagcgcgaccctcacccca
caaatttatcctgaaggtaaactccgctgtagcgcccctgtctttgagccaggcggcggc
gggattaacgtcgcacgagccatcactcatctcggtgggacagccacggctattttcccg
gcgggcggtgcgaccggtgaacatctggtggcgttgctggccaatgaacacgtggccgtc
gatacggtggaagccaaagactggacacgacagaacctgcatgtccatgtcgaatcgagc
ggcgaacagtaccgtttcgtcatgccaggcgccatgctggaagacaatgagtttcgccag
ctggaagagaaagtactcgcaatcgaaagcggtgccattctggtcatcagcggcagcctt
ccgccgggcgttaaatgcgaaaaactcacccacttgatagatgcagccaagaagaaaggc
ctgcgctgtattgtcgacagttccggcgaagcgctgaccgccgcgctggaatccggcaat
ctggaactgatcaaaccgaaccaaaaagagctgagtgcgctggtcaatcgtccgttaacc
cagcccgatgacgttcgttccgccgccgaggagctggtgcgtaacggcaaagcgcgtcgc
gtcgtggtgtcactggggccacagggtgcgctcggggtcgatgaaaccggttcggtgcag
gtcgtcccgccgccaatgaaaagccaaagcaccgtgggtgccggtgacagcatggtaggc
gcaatgaccttaaaactggcacaaggcgcgtcgctgctggaaatgacacgctatggcgtt
gcagcgggtagcgcagctactatcaatcatggtacgcggttgtgttcactcgaagatacg
caaaaaattgtggattatctcacccgcagctaa

DBGET integrated database retrieval system