KEGG   Lelliottia jeotgali: LJPFL01_2575Help
Entry
LJPFL01_2575      CDS       T05035                                 

Definition
(GenBank) Cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lef  Lelliottia jeotgali
Pathway
lef00500  Starch and sucrose metabolism
lef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LJPFL01_2575
Enzymes [BR:lef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LJPFL01_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: ASV55938
LinkDB All DBs
Position
2727702..2729189
Genome map
AA seq 495 aa AA seqDB search
MHNPTLLQCFHWYYPTGGELWREVTALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVPTKYGDKAQLLEAIDALKSNEIAVLLDVVVNHKMGADEKESIRVQRV
NEQDRTQIDDEVIECEAWTRYTFPVRAGQYSEFIWDYKCFSGIDHIENPNEDSIFKIVND
YTGDGWNDQVDDEMGNFDYLMGENIDFRNHAVTEELKYWARWVMDQTHCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQQYIEQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVESWFKPLAYALILLREN
GVPSVFYPDLFGASYEDTGGDGETYPIVMPVIEQLHELILARQRFAHGVQTLWFDHPNCI
AFSRSGTDEDPGCVVVMSNGDDGEKVLCLGENYGNRSWRDFLGNREETVTTAADGEGTFT
CKGGSVSIWVMEDVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaccccaccctattacaatgttttcactggtattaccccacgggcggtgaactg
tggcgggaagtgaccgcactggccccgaatctcaacgaaatcggcattaacatgatttgg
ctgccaccggcgtacaaaggcgcatcgggcggctattccgtcggatacgactcttacgat
ctgttcgatctcggtgagtttgatcagaaaggttcagtgccaaccaaatacggcgataaa
gcccagttgctggaagcgattgacgcgttaaaaagcaatgagatcgccgtactgctggac
gtggtggtgaaccacaaaatgggcgcagatgagaaagagtcgatccgcgtgcagcgggtg
aatgagcaggacagaacgcagattgacgacgaggtgatcgaatgtgaggcctggacgcgg
tacaccttcccggttcgcgccgggcagtattccgagtttatctgggattacaaatgcttc
agcggcatcgatcacattgaaaaccccaacgaagacagcatcttcaaaatcgtgaatgat
tacaccggcgacggctggaacgatcaggtcgatgatgagatggggaatttcgactacctg
atgggcgaaaacatcgattttcgcaatcatgcagtcaccgaagaattgaaatactgggcg
cgctgggtgatggatcaaacgcactgcgacggttttcgcctcgatgcggtaaaacatatt
cccgcatggttctataaagagtggatcgaacacgttcaggaagttgcgcccaagccgctg
tttattgtggccgaatactggtcgcatgaagtcgacaaactgcagcaatatatcgagcag
gtggaaggcaaaactatgctgttcgatgcgccattgcagatgaaattccatgaagcgtcc
cgccagggccgcgactacgacatgagccagattttcaccggcacgctggtcgaagccgat
ccgttccacgccgtgacgctggtcgccaaccatgacactcagccgttacaggcgctggaa
gccccggtcgaatcctggtttaaaccactggcctacgccctgattttgctgcgtgaaaat
ggcgtgccgagcgtattttatccggatttattcggtgccagctatgaagataccggcggg
gatggtgaaacctaccctatcgtgatgccggttatcgaacagctccacgaactgatcctc
gcacgccagcgctttgcccacggcgtgcagacgctatggtttgatcatccgaactgtatc
gccttcagccgcagcggcacggatgaagatccgggctgtgtcgtcgtgatgtccaacggg
gacgatggcgaaaaagtgctgtgtctgggggagaattacggtaacaggagctggcgagat
ttccttggcaaccgtgaagaaaccgtcaccaccgccgccgacggcgaagggacattcacc
tgcaaaggcggcagcgtgagtatctgggtaatggaggatgtgttgtag

DBGET integrated database retrieval system