KEGG   Lelliottia jeotgali: LJPFL01_2876Help
Entry
LJPFL01_2876      CDS       T05035                                 

Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lef  Lelliottia jeotgali
Pathway
lef00564  Glycerophospholipid metabolism
lef01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lef00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LJPFL01_2876
Enzymes [BR:lef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LJPFL01_2876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored NAD_binding_8 Pyr_redox_2 Thi4 DAO_C Pyr_redox HI0933_like 3HCDH_N Pyr_redox_3 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ASV56239
UniProt: A0A248T1H5
LinkDB All DBs
Position
3070701..3072329
Genome map
AA seq 542 aa AA seqDB search
MTIRDPRYSDVIIIGGGATGAGMARDCALRGLSVTLLERHDIATGATGRNHGLLHSGARY
AVTDNESARECIAENQILKRIARHCIEPTSGLFITLPEDDLAFQKTFITACTEAGITAEA
IAPELARRIEPAVNPALLGAVRVPDGTVDPFRLTAANMLDAREHGATILTAHEVTGLIRE
GDRVRGVRVYDHLYGEHSELYASVVVNAAGIWGQRIAEYAELSIRMFPAKGSLLILDHRI
NNHVINRCRKPSDADILVPGDTISLIGTTSTHIDYKDIDSNRVTAEEVDILLREGEKLAP
IMAQTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAARDGLEGFITITGGKLMTYRL
MAQWATDAVCRKLGNTQPCTTAERPLPGSQEPTEKTLQKIISLPAPLRGSAIYRHGDRTP
VWLGEGRLSRSLVCECEAVTAGEVQYAVENLTVNNLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSLTQLSEFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQHD
EV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccgcgatccccgttatagcgatgtgattatcattggtggcggcgcaacgggt
gccggaatggcgcgggactgcgccctgcgaggattaagcgttacgttgctggaacgccac
gatattgccactggcgccaccggacgcaatcatggcctgcttcacagcggcgcgcgctat
gccgtcaccgataacgagtcggcgcgcgagtgcattgctgaaaaccagatcctcaaacgc
atcgcccgccactgcatcgagccgaccagcggcctgtttatcaccctccccgaagacgat
ctcgcctttcagaaaacctttatcaccgcctgtaccgaagcgggtattaccgccgaagcg
atcgcccctgaacttgcgcggcgtatcgaacctgccgtgaaccctgccctgctcggcgcg
gtccgcgttcccgatggcaccgttgaccccttccgtctgacggccgctaatatgctcgat
gcccgcgagcacggcgcgactattctaacagcgcatgaagtgacggggctgatccgcgaa
ggcgacagagtgcggggcgtacgcgtctacgaccacctctacggcgaacacagcgagttg
tacgccagtgtggtagtgaacgccgcggggatctgggggcagcgtattgccgaatatgcc
gagctgtccattcgcatgttcccggccaaaggctcgctgctgatcctcgatcaccgcata
aacaatcacgtcatcaaccgctgccgtaagccgtccgacgccgacattctggtacccggc
gataccatttccctgattgggaccacctcgacgcacattgattacaaggatatcgacagc
aaccgtgtcaccgcggaagaggtggacatcctgctgcgcgaaggggaaaaactggcgccg
atcatggcgcaaacccgcattctgcgggcttattccggtgtgcgtccgctggtcgccagc
gatgacgatccaagcgggcgtaacgtcagccgtggcattgtcttgctggatcacgccgcc
cgcgacgggctggaagggttcattaccattaccggcggcaagctgatgacctaccgttta
atggcccaatgggcgacggacgccgtgtgccgcaagcttggcaatacgcagccctgcacc
accgccgaacgcccgctgcctggctcacaggagccgaccgaaaaaacgctgcaaaaaatc
atctcactgcccgccccactgcgcggctcagccatttatcgacacggcgatcgcacgccc
gtatggcttggagagggccgtctgagccgcagcctggtgtgtgagtgcgaggcagtgacg
gcgggcgaagtgcagtacgcggtggaaaatctgacggtcaacaatctgctcgatctgcgc
cgtcgcacccgtgtaggcatggggacctgtcagggcgaactgtgcgcctgccgcgcggcg
ggtctgttgcaacggtttaatgtcaccacgtcagcgcaatctctgacgcagctcagcgag
ttcctcaatgagcgctggaaaggggtgcagcctatcgcctggggcgacgcgctgcgcgaa
agcgaatttacccgctgggtctatcaggggctgtgcgggctggaaaaggagcagcacgat
gaagtttga

DBGET integrated database retrieval system