KEGG   Lelliottia jeotgali: LJPFL01_3971Help
Entry
LJPFL01_3971      CDS       T05035                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
lef  Lelliottia jeotgali
Pathway
lef00250  Alanine, aspartate and glutamate metabolism
lef00410  beta-Alanine metabolism
lef00640  Propanoate metabolism
lef00650  Butanoate metabolism
lef01100  Metabolic pathways
lef01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LJPFL01_3971
   00650 Butanoate metabolism
    LJPFL01_3971
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJPFL01_3971
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LJPFL01_3971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lef01007]
    LJPFL01_3971
Enzymes [BR:lef01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LJPFL01_3971
Amino acid related enzymes [BR:lef01007]
 Aminotransferase (transaminase)
  Class III
   LJPFL01_3971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASV57334
LinkDB All DBs
Position
complement(4237621..4238826)
Genome map
AA seq 401 aa AA seqDB search
MCGFYADKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPKVIAAIEKQLQSFTHTAYQIV
PYEGYIALAERINARVPIEGPAKTAFFSTGAEAVENAVKIARAYTKRPGLITFGGAFHGR
TFMTMALTGKVAPYKLGFGPFPGSVYHAQYPNTLHGVSSQDALKSLERIFKADIAPDQVA
AIILEPVQGEGGFNVAPPDFMQGLRALCDTHGILLIADEVQTGFARTGKLFSMEHHCVKP
DLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGNPLAIAAALAVLEVIDEEELC
TRASHLGHHLVEVLSKAQAACPFIADIRAQGSMVAVEFNDPETGQPSAEFTRLVQERALE
DGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIISAALTR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtttttacgccgataaagcggaaaacgccacgctgtgggatgtcgagggcaac
gaggtgatcgacttcgcggccgggattgcggtgctcaacaccggtcatcgccatcccaaa
gtgatcgccgccatcgaaaaacagctccagtcgtttacccacacggcgtaccagattgtg
ccgtacgaaggctacatcgccctcgcggagcgcatcaatgcgcgcgtaccgattgagggg
cccgccaaaacggctttcttctcgacgggcgcagaagccgtcgaaaacgcggtcaaaatc
gcccgcgcttacaccaaacgcccaggtctcatcaccttcggtggcgctttccacgggcgc
acctttatgacgatggcgctgaccggcaaagtggcaccgtacaaactcggcttcggccca
ttccccggctcggtctatcacgcccaatatcccaatacgctacacggcgtgagttctcag
gacgcgctgaaaagcctcgaacgtatctttaaagccgatatcgccccggaccaggtggcg
gcgatcatccttgagccggttcagggcgaaggcggatttaacgtcgcaccgcctgatttt
atgcaaggcctgcgtgcgctgtgcgatacccacggtatcttgcttatcgctgatgaagta
cagaccggttttgcccgtaccggcaagctattctcgatggaacaccactgcgttaaaccc
gatctgatcactatggcgaaaagcctggcgggcgggatgccgctgtcggcggtgtctgga
cgtgctgaagtcatggatgcccctgcacctggcgggctcggtggcacctacgccggtaac
ccattggcgattgcggcggcgctggcggtgctggaagtgatcgacgaagaagagctctgc
acccgcgcatcgcatctgggccatcatttggtggaagtattgagcaaagcccaggccgcc
tgcccgtttatcgctgatatccgtgcgcaaggctcaatggtcgcagtggaattcaacgat
cccgaaaccggacaaccctcagcagaatttacccgactggtgcaggaacgcgcgttggaa
gatgggctgttgctgctcagctgtggcgtgtacggcaacgtgattcgtttcctctatccg
ctcaccatccccgaagcccagttccgcaaagcgctggatatcatctctgcggcgctgact
cgataa

DBGET integrated database retrieval system