KEGG   Lelliottia jeotgali: LJPFL01_4005Help
Entry
LJPFL01_4005      CDS       T05035                                 

Definition
(GenBank) Polymyxin resistance protein PmrM
  KO
K12963  undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF
Organism
lef  Lelliottia jeotgali
Pathway
lef01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:lef00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LJPFL01_4005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:lef01005]
    LJPFL01_4005
Lipopolysaccharide biosynthesis proteins [BR:lef01005]
 Unusual sugar
  LJPFL01_4005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA Multi_Drug_Res
Motif
Other DBs
NCBI-ProteinID: ASV57368
LinkDB All DBs
Position
complement(4268131..4268520)
Genome map
AA seq 129 aa AA seqDB search
MKGIFWALCSVVLVSGAQLLLRSAMVSLPPVAEPLSLLRALFHFATGSGMLLLGLSGYIA
SMGCWYLALHRMALSRAYALLSLSYILVWIAAIVLPGWSERFSWAGLAGVGLIIAGVLVI
FLPAAKKVK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagggatattctgggcgctgtgcagcgtggtactggtcagtggggcgcagctcctg
ctgcgctcggcgatggtctctctcccgccggtcgctgaaccgctctctttactgagggcg
ttattccatttcgccacaggcagcggcatgttgcttttggggttgagcggttacatcgcc
tcgatgggctgctggtatctggcgctgcaccgcatggcgctgagcagggcctatgcgcta
ctcagcctgagctacattctggtgtggattgccgctatcgtgctacccggctggagtgaa
cgtttctcctgggccgggctggcgggcgtcggtttgattatcgcgggcgtactggttatt
tttctgccagcagcgaaaaaggtgaaatag

DBGET integrated database retrieval system