KEGG   Lelliottia jeotgali: LJPFL01_4150Help
Entry
LJPFL01_4150      CDS       T05035                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lef  Lelliottia jeotgali
Pathway
lef00620  Pyruvate metabolism
lef00680  Methane metabolism
lef01100  Metabolic pathways
lef01120  Microbial metabolism in diverse environments
lef01200  Carbon metabolism
Module
lef_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lef00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LJPFL01_4150
  Energy metabolism
   00680 Methane metabolism
    LJPFL01_4150
Enzymes [BR:lef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LJPFL01_4150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ASV57513
UniProt: A0A248T549
LinkDB All DBs
Position
4448454..4451105
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPDLNED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYERNQLMRRLRQ
LIAQSWHTDEIRKYRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEENLGYRLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIQILISELSMVDATPELL
ELVGEEGASEPYRYLMKNLRSQLLATQAWLEARLKGQRLPKPAGLLSQNEQLWDPLYACY
KSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDVRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRSWEPSEETSEVLNTCKAIVDAPKGSVAAYVISMAKTP
SDVLAVHLLLKEAGISFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKDAWRHIMDEL
SDISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQSELETMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKQELWGLGKELRELLEGDIKVVLAIANDSHLMEDLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEAGKEPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgctggga
gataccatcaaggacgcgctgggagagaacatcctcgaccgcgttgaaactatccgtaag
ctgtccaaatcctcccgtgcaggaaatgaagcgaaccgccaggagctgctcaccactttg
cagaacctgtccaacgacgagttgctgcccgtcgcacgcgcgtttagccagttcctgaac
ctggctaacaccgctgagcaatatcacagcatttcgccaaacggcgaagctgccagcaac
ccggaagtgattgcccgcacgctcagaaaactcaaagaccagcccgatctcaatgaagac
accatcaaaaaagcggtggaatccctctcgctggaactggtgctgactgcgcacccgacc
gagatcacccgccgcacgttgatccacaaaatggtggaagtgaacaactgcctgaaacag
ttggacaacaaagacatcgcggattacgagcgtaatcaactgatgcgtcgtctccgccag
ttgattgcccagtcctggcacacggatgaaatccgtaaatatcgcccaagcccggttgat
gaagccaaatggggctttgcagtcgtggaaaacagcctgtgggaaggcgtaccgaactac
ctgcgcgagctaaatgaacagctcgaagagaacctgggttatcgcctgccagtagatttt
gtcccggtccgtttcacctcctggatgggcggggaccgcgacggtaacccgaacgtcacc
gctgaaatcacccgccacgtcctgctcctgagccgctggaaagccaccgacctgttcctg
aaagatattcagatcctgatttctgaactgtcgatggtcgatgctacgccagaactgctg
gaactggtcggcgaagagggtgccagcgagccgtaccgctatctgatgaaaaatctgcgc
agtcagctgcttgcgacacaagcctggctggaagcgcgcctgaaaggccagcgcctgcca
aaaccggcggggctgttgagccagaacgaacagttgtgggacccactctacgcttgctat
aagtcattgcaggcctgtggcatgggcatcatcgccaacggcgaactgctcgacaccctg
cgtcgcgtgaagtgtttcggcgtgccgctggtgcgtatcgatgtgcgccaggaaagtacc
cgtcacaccgaagcgctgggtgaattgacccgctacctcggcatcggcgactatgaaagc
tggtcagaagccgacaaacaggccttcctgatccgcgagctgaactccaagcgcccgctc
ctgccacgcagctgggagccgagcgaagagaccagcgaagtgctcaacacctgcaaagcg
atcgttgatgcgccgaaaggatcggtggccgcctatgtgatctcaatggccaaaacccca
tccgacgtgctggccgtacatctgttgttgaaagaggcgggtatcagctttgcgctgccg
gttgccccactgtttgaaaccctcgacgacctgaataacgctaacgacgtgatgacccag
ctgctgaatatcgactggtatcgcggctttattcagggcaaacagatggtgatgattggc
tattccgattccgcaaaagacgcgggcgtgatggcggcctcctgggcgcagtatcaggcg
caggatgcactgatcaaaacctgcgaaaaagcgggtatcgaactgaccctgttccacggt
cgcggcggctctattggtcgcggcggtgcaccggctcatgcggcactgctctcccaaccg
ccgggtagcctgaaaggcggcctgcgcgtgaccgagcagggcgaaatgattcgctttaaa
tacggtctgccggaagtgacaatcagcagtctgtcgctctataccagcgcgattctggaa
gctaacttactgccgccgccggagccgaaagacgcgtggcgtcatatcatggacgagctg
tcagacatctcttgtgacctgtaccggggctacgtgcgtgaaaataaagacttcgtgccg
tacttccgctcggcaacgcctgagcaggagctgggcaaactgccgctcggttcacgtccg
gcgaaacgtcgtcctaccggcggtgtcgagtccctgcgcgccattccgtggatcttcgcc
tggacgcaaaaccgcctgatgctgcccgcctggctgggtgccggtgccgcgctgcaaaaa
gtggtcgaagacggtaagcaaagcgagctggaaaccatgtgccgcgactggccgttcttc
tctacccgtctgggaatgctggagatggtgttctcgaaagccgacctgtggctggcggaa
tactacgaccagcgcctggttaaacaggaactctggggtctgggcaaagagttgcgcgag
ctgctggaaggcgacatcaaagtcgtactggccatcgctaacgattcacatctgatggaa
gatttgccgtggattgccgagtccattcagctgcgtaatatctacaccgacccgctaaac
gtactgcaggcagagcttttacaccgctcccgtcaggcggaagaggcaggtaaagagccg
gacccacgcgtggaacaagcgctgatggtcaccatcgctggcgtcgccgctgggatgcgt
aatacgggctaa

DBGET integrated database retrieval system