KEGG   Leptospirillum sp. Group II: ABH19_09395Help
Entry
ABH19_09395       CDS       T04007                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
leg  Leptospirillum sp. Group II
Pathway
leg00473  D-Alanine metabolism
leg00550  Peptidoglycan biosynthesis
leg01100  Metabolic pathways
leg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:leg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABH19_09395
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABH19_09395
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ABH19_09395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:leg01011]
    ABH19_09395
Enzymes [BR:leg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ABH19_09395
Peptidoglycan biosynthesis and degradation proteins [BR:leg01011]
 Precursor biosynthesis
  Amino acid ligase
   ABH19_09395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AKS24836
UniProt: A0A0K0WR15
LinkDB All DBs
Position
complement(1854384..1855295)
Genome map
AA seq 303 aa AA seqDB search
MGGDSPEAAVSRMSGKAVLEALRSRGYEAIPVEAGPDLFHTLLRTSPDVCFLATHGGHGE
NGALQGCLEVLGIPYTGSGVLGSALGMSKSASRALFRQGGLDVPETVAIESGERLTPDKI
PFPLPFMVKPESAGSSIGVTRVDHFPDLPQALLEAEKHSSRILVEPFLPGREVQSAILDG
RYLGAIEIVPDSSEPFYTYASKYQKGKSRHIFPAPLTSDVASRLEEATLRAFGLLELRGV
ARMDTLVLPDGRVVVLEMNTLPGLTETSLVPEIARGCGLSFEDLVETILSSARLDTPAPT
PVC
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggaggggattctcccgaggcggccgtttcgcgcatgagtggaaaggctgttctggag
gccctgaggagtcgcgggtatgaggccattccggtggaagccggaccggaccttttccac
acgctgctccgcacttcgcccgatgtctgctttctggccacccacggaggtcacggtgag
aacggagccctgcaggggtgcctggaagtgctcggcattccctataccggctccggtgtt
ctcggaagtgctctcgggatgagtaaaagcgcctcccgagccctgtttcgtcagggagga
ctcgacgttccggagactgtcgcgatcgaatccggagagaggctgactccggacaagatt
cccttccctcttccctttatggtcaagccggaatcggcgggttcctcgatcggggtgaca
cgggtagaccatttcccggacctgcctcaagcgctcctcgaggcggaaaaacattcctcc
cgcattctcgtggagccgttccttccgggacgggaggtccagtccgccattctggacggc
cggtatctgggcgcgatagaaatcgttccggattcttcggagcccttttatacctacgca
tccaagtatcagaaaggaaaatcgcggcacatttttccggctcccctgacgagcgatgtt
gcttcccggcttgaagaagccactcttcgcgctttcggtcttctggagcttcgaggggtt
gcccgcatggacactttggtccttccggatggccgcgtggtcgtcctggaaatgaacacg
ttgccggggttgacggaaacctccctcgtccccgaaatcgccagaggatgcggcctctcg
tttgaggacctggtggaaacgattctgtcttcggcccgtttggatactcccgctccgaca
cctgtttgctag

DBGET integrated database retrieval system