KEGG   Leptospirillum sp. Group II: ABH19_13370Help
Entry
ABH19_13370       CDS       T04007                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
leg  Leptospirillum sp. Group II
Pathway
leg00620  Pyruvate metabolism
leg00680  Methane metabolism
leg01100  Metabolic pathways
leg01120  Microbial metabolism in diverse environments
leg01200  Carbon metabolism
Module
leg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:leg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABH19_13370
  09102 Energy metabolism
   00680 Methane metabolism
    ABH19_13370
Enzymes [BR:leg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ABH19_13370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 Curto_V2
Motif
Other DBs
NCBI-ProteinID: AKS24938
UniProt: A0A0K0WRN2
LinkDB All DBs
Position
2651592..2653088
Genome map
AA seq 498 aa AA seqDB search
MATQHPDNARAPYWKTNNDPFISTLDEIEECYRTYTDLGCQEYMWDWEGKYVDEGVVDKL
FSLYHPYFSENQLGKDVFLTFRLPNIWYEKEYRIARAYIGILTFEELSRDLGLNSPPVFE
VILPMTDEAQKMIYLKTTFRKIAKLKSQVFDETTEASDPSYLQVIPLIEGVPQLAASHNI
LMEYADLHQKEYGSKPSYLRPFIARSDPALNAGFIPATIAAKVALSEYYKFGQESGIAIF
PIMGVGSLPFRGGLNPFTVSQFLDEYPGVRTVTLQSAFRYDYPLDSVKEAIHSLNRALPF
TKPLTYTEEEIAMGERLAQLFSTIYQETVEEIADAINQISSHIPPRRERKLHIGLFGYSR
GIGQKRLPRAISFTGALYSLGVPPELIAIGRGIEAAIKENLEDALFMFCRHLKEDLRHAG
HYLNRENLRFFASGNPAWERILEDIIIAEKYFKLELGPVTTEHYLHRNIVSSIYFLTQEE
KDISPYLFDAALLRRSLG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacagcacccggataatgcgagagctccttactggaaaaccaacaatgatcct
ttcatcagcaccctggatgaaatcgaggaatgctacagaacctacacagatctcggttgt
caggaatacatgtgggactgggaagggaaatatgtggatgaaggcgttgtggacaagctt
ttttccctctatcatccctatttttccgaaaatcagctcggcaaggatgttttcctcaca
tttcgccttcccaacatttggtatgaaaaagagtatcgcattgcccgggcgtatatcgga
attctgactttcgaagagttgtccagagaccttggactcaattcacccccggtttttgaa
gtgattctgccgatgacagatgaagctcaaaaaatgatttacctgaaaacgacctttcgc
aaaattgccaaactcaaaagccaggtttttgacgaaacaacggaggccagcgacccgtcc
tatcttcaggtcatcccccttatcgaaggagtcccgcagctggcagcctcgcataacatc
ttgatggagtatgcggatcttcaccagaaagaatacggaagcaaaccgtcttatctcaga
ccttttattgcccgctcggatcccgccctgaacgccggctttattccggccacgattgca
gccaaagtcgccctgtcggaatattataagttcgggcaagaatcaggcatcgccatcttt
ccgatcatgggtgtcggttctttgccttttcggggaggactgaatccgttcacggtctcg
cagttcctggatgaatatcctggtgtccggacggtaacccttcaatccgcctttcgctat
gattatcctctcgacagcgtcaaggaagccatccattccttgaacagggctctccctttt
acaaaacctcttacctacacggaagaagaaattgcaatgggagagaggctcgcccaactt
ttttccacgatctatcaagagacagtggaagaaattgccgacgcgatcaaccagatttcg
tctcatattcctcccagaagagaacgaaaacttcatatcggtctttttggatattcccgg
ggaattggacaaaaaaggcttccccgcgccattagtttcacaggggctctctactccctg
ggggttcccccggaactgatcgctatcggaagagggatagaagcggccataaaggaaaac
cttgaagacgccctctttatgttttgcaggcatcttaaggaagatttacggcatgcaggc
cattatctcaaccgcgaaaacctgcggtttttcgcctctggaaatcctgcatgggaacgc
atactggaagatatcattattgcggaaaaatattttaagctcgaattaggtcctgtgacg
acagagcattacctgcatcgaaacattgtttcaagcatttactttttgacccaggaagaa
aaagatatttctccatacctctttgacgcggctcttttgagacgttctttagggtaa

DBGET integrated database retrieval system