KEGG   Leclercia sp. LSNIH3: C3F35_01585Help
Entry
C3F35_01585       CDS       T05316                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
leh  Leclercia sp. LSNIH3
Brite
Enzymes [BR:leh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C3F35_01585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AUY37568
LinkDB All DBs
Position
complement(326368..326886)
Genome map
AA seq 172 aa AA seqDB search
MKRFTLAMLTLVVCAGAQAASEEVKMNLVTPQGIGQSIGTVKITETDKGLEFSPDLNALP
PGEHGYHVHAKGSCEPAMKEGKPSAAEAAGGHLDPQNTGKHEGPEGMGHLGDLPALVVNN
DGKATDPVVAPRLKKLDEVKGKALMIHVGGDNMSDHPKPLGGGGARYACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttttactctggcaatgctgacactggtggtttgcgcaggtgcgcaggctgcc
agtgaagaagtaaagatgaacctcgtcaccccgcaagggataggccagtccattgggacg
gtaaaaattaccgaaacggataaaggactggagttctcccccgatctcaacgcccttcca
ccgggcgaacacggttatcacgtccacgccaaaggctcctgcgaaccggcaatgaaagag
ggtaaaccttccgccgctgaggctgcgggcggacacctcgatccacagaataccggcaaa
catgaagggccagagggcatgggccacctgggcgatctgcccgcgctggtcgtgaacaac
gacgggaaggccaccgatcctgtggtcgcgccgcgccttaaaaagcttgatgaagttaaa
ggtaaagcgctgatgatccacgttggcggcgacaacatgtccgatcaccctaaaccactc
ggcggtggcggggcgcgttacgcctgcggcgttatctga

DBGET integrated database retrieval system