Leclercia sp. LSNIH3: C3F35_02735 Help Entry C3F35_02735       CDS       T05316                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism leh  Leclercia sp. LSNIH3 Pathway leh01100   Metabolic pathways leh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:leh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C3F35_02735   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C3F35_02735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AUY37769 LinkDB All DBs Position complement(554309..554545) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system