KEGG   Leclercia sp. LSNIH3: C3F35_09150Help
Entry
C3F35_09150       CDS       T05316                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
leh  Leclercia sp. LSNIH3
Pathway
leh00250  Alanine, aspartate and glutamate metabolism
leh00280  Valine, leucine and isoleucine degradation
leh00310  Lysine degradation
leh00410  beta-Alanine metabolism
leh00640  Propanoate metabolism
leh00650  Butanoate metabolism
leh01100  Metabolic pathways
leh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:leh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C3F35_09150
   00650 Butanoate metabolism
    C3F35_09150
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C3F35_09150
   00280 Valine, leucine and isoleucine degradation
    C3F35_09150
   00310 Lysine degradation
    C3F35_09150
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C3F35_09150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:leh01007]
    C3F35_09150
Enzymes [BR:leh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C3F35_09150
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     C3F35_09150
    2.6.1.48  5-aminovalerate transaminase
     C3F35_09150
Amino acid related enzymes [BR:leh01007]
 Aminotransferase (transaminase)
  Class III
   C3F35_09150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUY38934
LinkDB All DBs
Position
1892936..1894219
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAVPRGVGQIHPIFAARAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
DVVSAVEEQLKKLSHTCFQVLAYEPYLELCETLNQKVPGDFPKKTLLVTTGSEAVENAVK
IARAATKRNGTIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGISD
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYATSPAFMQRLRDLCDEHGIMLIADE
VQSGAGRTGTFFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
SPIACAAALAVMKVFEQEDLLGKANKLGNTLREGLLAIAEKHPEIGDVRGLGAMIAIELF
EAGDHHKPDAALTAQIVARARDKGLILLSCGPYHNVLRILVPLTVEEEQLRQGLAIIAAC
FDEAKQE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaacaaagagttaatgcagcgtcgtagcaatgccgtaccccgtggtgtaggg
caaatccaccctatctttgccgcccgcgccgagaactgccgggtgtgggatgtcgaaggc
cgtgaatatcttgatttcgccgggggaattgcggtgctgaacaccgggcatctccaccct
gacgtggtgagcgccgtggaagagcagctgaaaaagctgtcgcacacctgcttccaggtg
ctggcctatgaaccctatctggagctttgcgaaactctgaaccagaaagtgccgggggat
ttcccgaaaaagaccctgctggtgaccaccggctccgaagccgtcgagaacgcggtgaag
attgcccgcgcggcgacgaagcgcaacggcaccatcgcctttaccggggcctatcatggc
cgcacccactacaccctctccctgaccgggaaagtgaacccttactcagcaggcatgggg
ctgatgccgggccacgtctatcgcgcgttgtatccgtgcgccctgcacggcatcagcgat
gacgacgccatcgccagcatccatcgcatcttcaagaacgatgccgcgccggaagatatc
gccgctatcgtgattgaacctgtccagggtgaaggcgggttctacgccacctccccggcc
tttatgcagcgcctgcgcgacctgtgcgacgagcacggcatcatgctgatcgccgatgaa
gtgcagagcggcgcgggccgcaccggcaccttcttcgccatggagcagatgggcgtggcg
gcggatatcaccaccttcgctaaatccattgctggcggcttcccgctggcgggcgtcacc
ggacgtgccgaagtgatggatgccatcgccccgggcgggctgggcggcacgtacgccggt
agccctatcgcctgtgccgccgcgctggcggtgatgaaggtgttcgagcaggaagatctg
ctgggcaaagccaataaactgggcaataccctgcgcgaaggcctgctggctatcgctgaa
aaacatcctgagatcggcgacgttcgcggcctgggggcgatgatcgccatcgaactgttt
gaagcgggcgaccaccataagccggacgccgccctgacggcgcagattgtggcgcgtgcg
cgggataaagggctgatcctgctctcctgcggcccgtatcacaacgtgctgcgcatcctg
gtgccgctcaccgttgaggaagaacagctccggcaggggctggcgattatcgccgcatgt
tttgacgaggcgaagcaggaataa

DBGET integrated database retrieval system