KEGG   Leclercia sp. LSNIH3: C3F35_13625Help
Entry
C3F35_13625       CDS       T05316                                 

Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
leh  Leclercia sp. LSNIH3
Pathway
leh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
leh01100  Metabolic pathways
leh01110  Biosynthesis of secondary metabolites
leh01130  Biosynthesis of antibiotics
leh01230  Biosynthesis of amino acids
Module
leh_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:leh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C3F35_13625
Enzymes [BR:leh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C3F35_13625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA AAA_16 APS_kinase AAA_22 TsaE ABC_tran AAA_7 AAA_5 Ploopntkinase3 AAA_17 RNA_helicase His_biosynth AAA_PrkA AAA_25 AAA_28 AAA_29 RsgA_GTPase PduV-EutP Mg_chelatase AAA_24 IstB_IS21 AAA_14 GTP_EFTU MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AUY39740
LinkDB All DBs
Position
2827654..2828175
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVETPPREVLEALAGERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgatgtagaaggcgaagagggtttccgt
gaccgtgaagaaaaagtcattaatgaacttacggaaaaacagggcattgtgctggctact
ggcggcggctctgtaaaatctcgcgaaactcgcaaccgtctctccgcccgcggtgtcgtg
gtctatcttgaaacgaccatcgaaaaacaactggcgcgtacgcagcgtgataaaaaacgc
ccgttgctgcaggttgagacgcctccacgcgaagttctggaagccctggctggtgaacgc
aatccgctgtacgaagagattgctgacgtcaccattcgcaccgacgaccagagcgctaaa
gtggtcgcaaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system