KEGG   Leclercia sp. LSNIH3: C3F35_14820
Entry
C3F35_14820       CDS       T05316                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
leh  Leclercia sp. LSNIH3
Pathway
leh00052  Galactose metabolism
leh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:leh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C3F35_14820
Enzymes [BR:leh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     C3F35_14820
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N 3HCDH_N ADH_zinc_N_2 Methyltransf_25 MTS PrmA DAO Shikimate_DH XdhC_C Methyltransf_31 ThiF
Other DBs
NCBI-ProteinID: AUY39955
LinkDB
Position
complement(3040736..3041779)
AA seq 347 aa
MKSVVIHAEGQVRVEERPVPDIQAADDVRVRVVCSGLCGSDIPRIFAKAAHYYPITLGHE
FSGYVDVCGSGIDDLEAGDAVACVPLLPCFSCPECKKGYFSLCKQYQFVGSRSEGGNAEY
IVVKRANLFRLPAEMAIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLAMQCA
LALGAASVTAIDINDDKLALATSLGANRVFNSKTLSADEMLAALHETRFDQLVLETAGTP
QTVALAIDIAGPRAQVVLVGTLHHDLNLSAATFGKILRKELTLQGSWMNYSAPWPGVEWE
TAARLLCEKKLRLEPLIALTGDSENFAHAIQALNGSPMQGKILLRLE
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaattcatgctgaggggcaggtgcgcgtggaagagcgccctgtcccg
gacattcaggctgcagatgacgtgcgcgtgcgcgtggtctgctcgggattatgcggttcg
gatatcccgcgtatttttgccaaagcggctcactattaccctatcaccctgggtcatgaa
ttcagcggctacgttgacgtctgtggctcaggcatcgacgatctggaggctggcgatgca
gtcgcgtgcgttccgctactgccctgcttctcctgcccggagtgtaaaaaaggctacttc
tcgttgtgtaagcaataccagttcgtcggctcccgcagcgaaggcgggaacgccgagtac
attgtggtgaagcgcgctaatctgttccgtctgcctgcggagatggccattgaagacggc
gcctttatcgagcctatcaccgtcgggttgcatgcattccaccttgcccagggctgtgag
ggcaaaaatgtgattatcgtgggggcgggcactatcggcctgctggccatgcaatgcgcg
ttggcgttgggtgcggcaagcgtgactgccattgatatcaatgatgataagctggcgctg
gcgacctcgctaggggcaaaccgggtattcaacagtaaaaccctcagtgcagatgagatg
ctggcggcccttcacgagacgcgttttgatcagctggtgctggagacggctggcacaccg
caaaccgtcgcccttgctatcgatatcgccgggccacgcgcccaggtggtgctggtagga
accctgcaccatgacctgaatttatctgccgcgacctttggcaagatcctgcgcaaagag
ctgaccctgcaaggcagctggatgaactactctgcgccatggccaggggttgagtgggag
accgctgcccggttgctttgcgaaaaaaaattgcgactggagccactgatcgccctgacc
ggcgacagcgaaaattttgcccatgccattcaggcactaaatggatcaccaatgcagggt
aaaatcctgctgcgcctggaataa

DBGET integrated database retrieval system