KEGG   Leclercia sp. LSNIH1: C2U54_04260Help
Entry
C2U54_04260       CDS       T05297                                 

Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lei  Leclercia sp. LSNIH1
Brite
Enzymes [BR:lei01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C2U54_04260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4600
Motif
Other DBs
NCBI-ProteinID: AUU83274
UniProt: A0A2I8NPF8
LinkDB All DBs
Position
complement(823996..824616)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFASLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKSAIERDFGSVENFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccgtacgcttacgacgccctggagccgcatttcgac
aagcagacgatggaaatccatcacaccaaacaccaccagacttacgttaacaacgccaac
gcggcgctggaaagcctgccagaattcgcgagcctgccggttgaagagctgatcaccaaa
ctggatcagctgccagccgacaagaaaaccgtactgcgcaacaacgcgggcggccatgct
aaccacagcctgttctggaaaggcctgaaaaccggtactactctgcagggcgacctgaaa
tccgctattgagcgcgacttcggctccgttgagaacttcaaagctgagtttgaaaaagcg
gctgctacccgtttcggctccggctgggcgtggctggttctgaaaggcgacaaactggcg
gtagtctctacggctaaccaggactccccgctgatgggtgaagcgatctctggcgcatcc
ggtttcccaatcctgggtctggacgtgtgggaacacgcttactacctgaaattccagaac
cgtcgtccggactacatcaaagccttctgggacgtcgtcaactgggacgaagctgcggca
cgtttcgctgctaaaaaataa

DBGET integrated database retrieval system