KEGG   Leclercia sp. LSNIH1: C2U54_07535Help
Entry
C2U54_07535       CDS       T05297                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
lei  Leclercia sp. LSNIH1
Pathway
lei00250  Alanine, aspartate and glutamate metabolism
lei00280  Valine, leucine and isoleucine degradation
lei00310  Lysine degradation
lei00410  beta-Alanine metabolism
lei00640  Propanoate metabolism
lei00650  Butanoate metabolism
lei01100  Metabolic pathways
lei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C2U54_07535
   00650 Butanoate metabolism
    C2U54_07535
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2U54_07535
   00280 Valine, leucine and isoleucine degradation
    C2U54_07535
   00310 Lysine degradation
    C2U54_07535
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2U54_07535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lei01007]
    C2U54_07535
Enzymes [BR:lei01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C2U54_07535
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     C2U54_07535
    2.6.1.48  5-aminovalerate transaminase
     C2U54_07535
Amino acid related enzymes [BR:lei01007]
 Aminotransferase (transaminase)
  Class III
   C2U54_07535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUU83876
UniProt: A0A2I8NQ70
LinkDB All DBs
Position
complement(1494859..1496142)
Genome map
AA seq 427 aa AA seqDB search
MSSNKALMQRRSNAIPRGVGQIHPIFAARAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
EVVSAVEEQLKKLSHTCFQVLAYEPYLELCETLNQKVPGDFPKKTLLVTTGSEAVENAVK
IARAATKRNGTIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSD
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYATSPAFMQRLRTLCDEHGIMLIADE
VQSGAGRTGTFFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
SPIACAAALAVMKVFEQEDLLGKANKLGNTLREGLLAIAEKHREIGDVRGLGAMIAIELF
EEGDHHKPDAALTAQIVARARDKGLILLSCGPYHNVLRILVPLTVEEAQLQQGLAIIAEC
FDEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagcgttaatgcagcgtcgtagcaatgccatcccccgcggcgtgggc
cagatccacccgatctttgccgcccgcgccgagaactgccgggtgtgggacgtcgaaggc
cgtgagtatcttgatttcgccggggggattgcggtgctgaacaccgggcatctgcacccg
gaggtggtgagcgccgtggaagaacagctgaaaaagctgtcgcacacctgcttccaggtg
ctggcctatgaaccctatctggagctttgcgaaaccctgaaccagaaagtgccgggggat
ttcccgaaaaagaccctgctggtgaccaccggctccgaagcggtggagaacgcggtgaaa
atcgcccgcgccgccacgaagcgcaacggcaccatcgcctttaccggggcctaccatggc
cgcacccactataccctgtcgctgaccgggaaagtgaacccttactcggcgggaatgggg
ctgatgccgggccacgtctatcgcgccctctatccctgcgccctgcacggcgtgagcgat
gatgacgccatcgccagcatccatcgcatcttcaagaacgatgccgccccggaagatatc
gccgccatcgtgatcgagcccgtccagggtgaaggcggcttctacgccacctcccctgcc
tttatgcagcgtctgcgcaccttgtgcgacgagcacggcatcatgctgattgccgatgaa
gtgcagagcggcgcaggccgcaccggcaccttcttcgccatggagcagatgggcgtggcg
gcggatatcaccaccttcgccaaatcgattgccggcggcttcccgctggcgggcgttacc
ggccgcgccgaggtgatggacgccatcgccccgggcgggctgggcggcacctacgccgga
agccccatcgcctgcgccgccgcgctggcggtgatgaaggtgttcgagcaggaagatctg
ctgggcaaagccaataagctgggcaacaccctgcgtgaagggctgctggctatcgctgaa
aaacaccgggagatcggcgacgttcgcggcctgggggcgatgatcgctatcgagctattt
gaagagggcgaccaccataaaccggacgctgcgctgacggcgcagattgtggcccgggcg
cgggacaaggggttgatcctgctctcctgcggcccgtaccataacgtgctgcgcatcctg
gtgccgctgaccgtggaagaggcgcagcttcagcaggggctggcgattatcgccgagtgt
tttgacgaggcgaaacagggttaa

DBGET integrated database retrieval system