KEGG   Leclercia sp. LSNIH1: C2U54_09660Help
Entry
C2U54_09660       CDS       T05297                                 

Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
lei  Leclercia sp. LSNIH1
Brite
KEGG Orthology (KO) [BR:lei00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lei01002]
    C2U54_09660
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lei01011]
    C2U54_09660
Enzymes [BR:lei01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C2U54_09660
   3.4.21  Serine endopeptidases
    3.4.21.-  
     C2U54_09660
Peptidases and inhibitors [BR:lei01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   C2U54_09660
Peptidoglycan biosynthesis and degradation proteins [BR:lei01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   C2U54_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AUU84260
UniProt: A0A2I8NR99
LinkDB All DBs
Position
complement(1948568..1949725)
Genome map
AA seq 385 aa AA seqDB search
MKRCLFLSAALYAASLTSAQAVEPITDPAFASDVVDRYANHIFYGSGATGMALVAIDGNQ
RVFRSFGETRPGNNIHPQLDSVVRIASLTKLMTSEMLVKLLDQGVVKLNDPLSKYAPPGA
RVPTYQGAPITLVNLATHTSALPREQPGGAAHRPVFVWPTRDQRWNWLSTATLKSSPGSQ
AAYSNLAFDLLADALGNAAGKPYAQLFEEQITRPLGMKDTTFTPSPDQCKRLMVAEKGAS
PCNNTLAAVGSGGVYSTPGDMMRWMQQFLSSDFYARSNQADRMQTLIYQRSQLSRVIGMD
VPGRADALGLGWVYMAPKNGRPGIIQKTGGGGGFITYMAMIPQSNVGVFVVVTRSPLTRF
VNMSDGVNQLVVELSENKPRVIPAS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgttgtctgttcctctccgccgcgctgtatgcggccagcctcaccagcgcgcag
gctgtcgagccgattaccgacccggcttttgcctccgatgtggttgatcgctacgcgaat
catattttttacggcagtggcgcaacggggatggctctggtggcgattgacggcaaccag
cgcgtattccgcagctttggcgaaacgcgcccgggcaataatatccatccgcagcttgat
tctgtagtgcgcatcgcctccctgaccaagttaatgaccagtgagatgctggtgaaactg
ctcgatcagggcgtggttaagctcaacgatccgttaagtaaatatgcgccaccgggcgcc
cgggtgccgacatatcagggcgcgccgattacgctcgtcaacctggctacccacaccagc
gccctgccgcgcgaacagccaggcggcgcggcccaccgtccggtcttcgtctggccaacc
cgcgatcagcgctggaactggctgtcgacagccaccctgaaatcatccccgggctcccag
gccgcctattcgaacctggcgttcgatctgctggccgatgcgctgggcaacgccgcgggc
aagccctacgcccagctgttcgaagagcagatcacccgtccgctggggatgaaagatact
acctttactccgtcacccgatcagtgcaaacgcctgatggtggcagagaaaggggccagc
ccgtgtaataacaccctggcggcggtcggtagcggcggggtttactccactcctggcgac
atgatgcgctggatgcagcagttcctctcctctgatttctacgcgcgcagcaaccaggcc
gacagaatgcagactctgatctatcaacgcagccagttaagccgggtgatcgggatggat
gtaccaggccgtgcggacgcgctgggccttggctgggtctatatggcacctaaaaatgga
cggcctggcattattcagaaaaccggcggtggcggcggattcatcacctatatggcgatg
atcccgcaatctaacgtgggcgtatttgtggtggtaacgcgctcgccgctcacgcgtttc
gtcaacatgagcgacggcgttaaccagctggtggtggagctgagcgagaacaaaccgcgg
gttatcccggcatcctga

DBGET integrated database retrieval system