KEGG   Leclercia sp. LSNIH1: C2U54_10950Help
Entry
C2U54_10950       CDS       T05297                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lei  Leclercia sp. LSNIH1
Brite
KEGG Orthology (KO) [BR:lei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U54_10950
Enzymes [BR:lei01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C2U54_10950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like NAD_binding_8 FAD_oxidored Thi4 FAD_binding_3 Glutaredoxin K_oxygenase AlaDh_PNT_C DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: AUU84501
UniProt: A0A2I8NRY9
LinkDB All DBs
Position
2220452..2222017
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIADLSEKVTFKEDNTLAV
RKPSFLITNPGSTQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGVFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLAEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYEVDVIDSQSASKLVPAAQEG
GFHQIETASGAVLKARSVIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLNNVDIILNAQTTEVTGD
GSKVTGLEYRDRVSGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDHLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcaaagcctaccttgagaagctgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgctg
gcggagatcgccgacctgtccgaaaaggtcacttttaaggaagacaacacccttgcggtg
cgtaaaccctctttcctgatcaccaacccaggttcgacccaggggccgcgctttgccggt
tctccgctgggacatgaatttacctcactggtactggccctgctgtggaccggtggtcat
ccgtcgaaggaagcgcaggcattacttgagcagatccgcgacctggatggtgattttgaa
ttcgaaacctactactcgctctcctgccataactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgctgaacccgcgcatcaaacacaccgccattgacggcggggtgttccag
aacgaaatcaccgatcgtaacgtgatgggtgttccggcggtgtttgtgaacggtaaagag
ttcggtcagggtcgtatgacgctggctgaaatcgtcgctaaagtggataccggcgcggaa
aaacgtgcagcagaagagctgaacaagcgtgatgcctatgacgtgctgattgtcggttcc
ggcccggcgggtgcggcggctgcggtttactctgcccgtaaaggtattcgcaccggtctg
atgggcgaacgctttggcggccaggtactggatacggtggatattgaaaactatatctcc
gtgcctaaaaccgaaggtcagaaactggctggcgccctgaaagcgcacgtcagcgaatat
gaagtggatgtgatcgacagccagagcgccagcaaactggtgccggcagcgcaggaaggc
ggtttccaccagattgaaacggcatctggtgccgtgctgaaagcgcgcagcgtgatcatt
gctaccggtgccaaatggcgcaacatgaacgtgcctggcgaagaacagtatcgcaccaaa
ggggtaacctactgcccgcactgcgacggcccgctcttcaaaggcaaacgcgtggcggta
attggtggcggtaactccggtgtggaagcggccatcgacctcgccggtatcgtggagcac
gttacgctgctggagttcgcgccagagatgaaagccgatcaggtcctgcaggataaagtg
cgcagcctgaacaacgtcgacatcatcctgaacgcgcagaccaccgaagtgacaggcgat
ggcagtaaagtgaccggccttgagtaccgcgaccgcgtgagcggcgacgtacacagcgtt
cagctttcggggatctttgtgcagattggtctgctgccgaacaccacctggctggaaggc
gccattgagcgtaaccgcatgggcgagatcatcatcgacgccaagtgtgagaccagcgtg
aagggcgtatttgcggcgggcgactgcaccaccgtaccgtacaaacagatcatcatcgcc
accggcgaaggggcgaaagcgtcactgagcgcctttgatcatctgattcgtaccaaaaca
gcataa

DBGET integrated database retrieval system