KEGG   Leclercia sp. LSNIH1: C2U54_20260Help
Entry
C2U54_20260       CDS       T05297                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lei  Leclercia sp. LSNIH1
Pathway
lei00010  Glycolysis / Gluconeogenesis
lei00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C2U54_20260
   00500 Starch and sucrose metabolism
    C2U54_20260
Enzymes [BR:lei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     C2U54_20260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AUU86203
UniProt: A0A2I8NXU9
LinkDB All DBs
Position
complement(4094776..4096170)
Genome map
AA seq 464 aa AA seqDB search
MKTFPDDFLWGGAVAANQVEGAYLDDGKGLSTSDVQPQGVFGPVVERVAGDSGIKDVAID
FYHRYPEDIRLFAEMGFSCLRVSIAWTRIFPNGDEQQPNEAGLAFYDKLFDELAAHNITP
LVTLSHYEMPWGLVKQYGGWGSRQTIGFFERYARTVFTRYQHKVKLWLTFNEINMSLHAP
MTGVGLPETSSKAEVYQAIHHQLVASALAVKACHEIIPDAKIGNMLLGGLVYPLTCKPDD
VLEALQENRAWQFFGDVQCRGAYPGYMLRFFRDHGITLDVTEADREALKTTIDFISFSYY
MTGCVTTDEELNQQARGNILSMVPNPHLASSEWGWQIDPVGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKPDADGRVQDDYRISYLNDHLVQVREAIDDGVEVMGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDSGAGTLARSRKKSFYWYQEVIATKGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttcccggacgatttcttatggggcggcgcggttgccgcgaatcaggtagaa
ggcgcttatctggacgatggcaaaggattgtccacctctgacgtacagccccagggggtg
tttggcccggtggtggagcgcgtggcgggcgacagcggtatcaaagacgtggcgatcgat
ttctatcatcgctacccggaggacatcagactgtttgccgaaatgggcttcagctgcctg
cgcgtctccattgcctggacgcgtatcttcccgaacggcgatgaacagcagccgaacgag
gccggactggctttctacgacaaactgtttgacgagctggcggcccacaacatcaccccg
ctggtgaccctttcgcactacgagatgccgtgggggctggtgaagcagtacggcggctgg
gggagccgccagacgatcgggttcttcgagcgttatgcccgcaccgttttcactcgctat
cagcacaaggtaaagctgtggctcacctttaacgaaatcaatatgtccctgcacgcgccg
atgaccggtgtcggcctgccggaaaccagcagcaaggcggaggtctatcaggcgatccat
catcagctggtggcgagcgcgctggcggtaaaagcctgccacgagatcatcccggatgcc
aaaatcggcaacatgctgctgggcggcctggtctatccgctgacctgcaagccggacgac
gtgctggaagccctgcaggaaaaccgcgcctggcagttcttcggcgacgtgcagtgccgc
ggggcgtacccgggctatatgctgcgcttcttccgcgatcacggcatcacgcttgacgtc
acggaggccgatcgcgaggcgctgaaaacgaccatcgactttatctccttcagctactac
atgaccggctgtgtcactaccgatgaagaactgaaccagcaggcgcgcggcaacatcctc
agcatggtgcctaacccgcatctggcaagctcggagtggggctggcagattgacccggtt
ggcctgcgtaccctgctgaacgtgctctgggatcgctatcagaagccgctgtttattgtt
gagaacggcctgggggcgaaggacaagccggacgccgacggcagggtgcaggatgattac
cgcatcagctatctcaacgaccacctggtgcaggtgcgcgaggcgattgacgacggcgtg
gaagtgatgggctacaccagctgggggccgatcgatctggtgagtgcttccaaagcggag
ctctcaaaacgctacggctttatctatgtcgatcgtgacgacagcggggccggcaccctg
gcgcgcagccgcaagaagagtttttactggtatcaggaggtgattgcgaccaaaggcgct
tcgctgaaagcctga

DBGET integrated database retrieval system