KEGG   Leisingera sp. NJS204: ETW24_04190Help
Entry
ETW24_04190       CDS       T05817                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00020  Citrate cycle (TCA cycle)
lej00190  Oxidative phosphorylation
lej00650  Butanoate metabolism
lej01100  Metabolic pathways
lej01110  Biosynthesis of secondary metabolites
lej01120  Microbial metabolism in diverse environments
lej01130  Biosynthesis of antibiotics
lej01200  Carbon metabolism
Module
lej_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lej_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lej_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETW24_04190
   00650 Butanoate metabolism
    ETW24_04190
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETW24_04190
Enzymes [BR:lej01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ETW24_04190
    1.3.5.4  fumarate reductase (quinol)
     ETW24_04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO FAD_oxidored GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: QAX28642
UniProt: A0A481PI11
LinkDB All DBs
Position
824281..826086
Genome map
AA seq 601 aa AA seqDB search
MAAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASL
GNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSDDGQ
CQGVVCWKLDDGTMHIFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTME
IREGRGVGAEGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYWGEVLNPTADDPTGVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRASAI
RAGKVVDPEAANPVLNTASVDKAFDRFDALRNAKGSIPTADLRLEMQKCMQADAAVFRTA
ETMAEGVEKMTAIAAKLDDLQVTDRSLVWNSDLMETLELTNLMPSALATIVGAEARKESR
GAHAHEDFSTRDDENWRVHTVSRVAGNKVELSYRPVITDPLSTEEEGGISLAKIAPKART
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttacgaatacgaaacacatgaatatgacgtggtcgtggttggcgccggcggg
gctggcctccgcgcgacgctgggcatggcggaacaggggctgcgtactgcatgcgtgacc
aaggtgttcccgacccgctcccacaccgtggcggcgcagggcggtattgccgccagcttg
ggcaacatgggtcccgacagctggcagtggcatatgtatgacaccgtcaagggctccgac
tggctgggcgacaccgacgcgatggagtatctggcgcgcgaagcccccaaggcggtttac
gagctggaacactatggcgtgccgttctcgcgcactgaggaaggcaagatctaccagcgc
ccgttcggcggccacaccaccgagttcggtgaaggccccgccgtgcagcgcacctgtgcc
gccgctgaccgcaccggccacgcgatcctgcacacgctttatggccaaagcctaaagaac
aacgccgaattctatattgagtatttcgccatcgacctgatcatgtccgacgacgggcag
tgccagggcgtggtgtgctggaagcttgatgacggcaccatgcatatcttcaacgccaag
atggtggtgctggcgaccggcggttatggccgcgcctatttctccgccacttcggcgcat
acctgcaccggcgacggcggaggcatggtggcccgtgccggcctggcgctgcaggacatg
gagttcgtgcagttccacccgaccggtatttacggctccggctgcctgatcaccgagggc
gcgcggggcgagggcggctacctcaccaactccgaaggcgaacggttcatggagcgctat
gcgccccagtacaaagacctggcgccgcgcgactatgtttcccgctcgatgacgatggaa
atccgcgaaggccgcggtgtgggcgccgagggcgaccatatccacctgaacctttcacat
ctgcccgccgaggcgctggcggaacggctgccgggcatttccgagagcgccaagatcttt
gccggtgtggacgtcaccaaggaaccgatcccggttctgcccaccgtgcactacaacatg
ggcggcatcccgaccaactattggggcgaggtgctgaacccgacggctgacgatccgacc
ggtgttgtgccgggcctgatggccgtgggcgaggctggctgtgcctcagtgcatggcgcc
aaccggcttggctccaactcgctcattgacctggtggtctttggccgtgcctcggccatc
cgcgcgggcaaggttgtggatcctgaggcggcgaacccggtgctgaacacggcttctgtt
gataaggcgtttgaccgttttgatgccctgcgcaatgccaaaggcagcatcccgactgcg
gatctgcggctggagatgcagaaatgcatgcaggccgacgccgctgtgttccgcactgcg
gaaaccatggccgaaggcgtcgagaagatgaccgcgatcgccgccaagctggacgacctg
caggtgaccgaccggtcgctggtctggaactccgacctgatggaaacgctggagctgaca
aacctgatgccaagcgcgctggccaccattgttggcgccgaggcccgcaaggaaagccgc
ggcgcccacgcgcatgaggatttctcgacccgcgacgatgaaaactggcgtgtccacacc
gtttcccgcgtggcgggcaacaaggtagagctcagctaccgtccggtgatcaccgacccg
ctgtccaccgaagaagaaggcggcatcagccttgccaaaatcgcgcccaaggcgcggacg
ttctaa

DBGET integrated database retrieval system