KEGG   Leisingera sp. NJS204: ETW24_04195Help
Entry
ETW24_04195       CDS       T05817                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00020  Citrate cycle (TCA cycle)
lej00190  Oxidative phosphorylation
lej00650  Butanoate metabolism
lej01100  Metabolic pathways
lej01110  Biosynthesis of secondary metabolites
lej01120  Microbial metabolism in diverse environments
lej01130  Biosynthesis of antibiotics
lej01200  Carbon metabolism
Module
lej_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lej_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lej_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETW24_04195
   00650 Butanoate metabolism
    ETW24_04195
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETW24_04195
Enzymes [BR:lej01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ETW24_04195
    1.3.5.4  fumarate reductase (quinol)
     ETW24_04195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_9 Fer2 Fer4_16 Fer4_22 Fer4_18
Motif
Other DBs
NCBI-ProteinID: QAX28643
UniProt: A0A481PHG4
LinkDB All DBs
Position
826098..826877
Genome map
AA seq 259 aa AA seqDB search
MVQFSLPKNSKITTGKTWPKPDGASNVRKFKIYRWNPDDGQNPRVDTYFLDMDSCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGMDEIKGDVAIYPLPHMP
VVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWKQSIEDRKKLDGLYECVMCASCSTSC
PSYWWNGDRYLGPAALLHAYRWIIDSRDEATPERLDQLEDPFKLYRCHTIMNCAKTCPKG
LNPAKAISHIKQMMVERSV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattcagcctcccgaagaactctaagatcaccacgggcaaaacctggcccaag
ccggacggcgccagcaatgtgcgcaagttcaagatctaccgctggaacccggatgacggc
cagaacccgcgtgtcgatacctatttcctggacatggacagctgcgggccgatggtgctg
gacgcgctgatcaagatcaagaacgagattgatccgaccctgaccttccgccggtcctgc
cgcgaagggatctgcggctcctgcgcgatgaacattgacggcatcaatacgctggcctgt
atctatggcatggatgagatcaagggtgatgtggcaatctatccgctgccgcatatgccg
gtggtcaaggaccttattcccgacctcacgcatttctatgcccagcatgcttcaatcatg
ccttggctggaaaccaagaccaaccgccccgcaaaggagtggaaacagtcgattgaggac
cgcaagaagctggatgggctttatgagtgcgtgatgtgcgccagctgctcgacctcctgc
ccaagctactggtggaacggcgaccggtaccttgggcccgcagccctgctgcatgcttac
cgctggatcatcgacagccgcgatgaggccacgcctgaacgtctggatcagctggaagac
ccgttcaagctttaccgctgccacaccatcatgaactgtgccaagacctgtcccaagggt
ctgaacccggccaaggcgatttcgcatatcaagcaaatgatggtcgagcgcagcgtttga

DBGET integrated database retrieval system