KEGG   Leisingera sp. NJS204: ETW24_10055Help
Entry
ETW24_10055       CDS       T05817                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00061  Fatty acid biosynthesis
lej00780  Biotin metabolism
lej01100  Metabolic pathways
lej01130  Biosynthesis of antibiotics
lej01212  Fatty acid metabolism
Module
lej_M00083  Fatty acid biosynthesis, elongation
lej_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lej00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETW24_10055 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETW24_10055 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ETW24_10055 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lej01004]
    ETW24_10055 (fabI)
Enzymes [BR:lej01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ETW24_10055 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ETW24_10055 (fabI)
Lipid biosynthesis proteins [BR:lej01004]
 Fatty acid synthase
  Component type
   ETW24_10055 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: QAX29680
UniProt: A0A481PKI1
LinkDB All DBs
Position
2046064..2046867
Genome map
AA seq 267 aa AA seqDB search
MSNHLMAGKRGLIMGLANDKSIAWGIAKACADAGAELAFSYQGDALKKRVAPLAAQLGSD
IVLPCDVSDEASIDALFAGLEAKWGKLDFVVHAIGFSDKNELRGRYVDTSRSNFQMTMDI
SVFSFTAVANRAEKMMSEGGSLLTLTYYGAEQVMPHYNVMGVAKAALEASVKYLAEDLGK
DGIRVNAISAGPIKTLAASGIGDFRYIMKWNEYNSPLRRNVTTDDVGKSALYLLSDLSSG
VTGENLHVDAGYHVVGMKAVDAPDISK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcacctgatggccggcaagcgcggcctcatcatgggcctggccaatgacaaa
tccatcgcttgggggattgccaaggcctgcgccgatgccggcgccgagcttgccttttca
tatcagggcgacgcactgaaaaagcgggtcgccccgctggcggcgcagctgggcagcgat
atcgtgctgccgtgcgacgtctcggacgaagcgtccattgacgccttattcgccggtctg
gaagccaaatggggcaagctggactttgttgtccacgccatcggcttttccgacaagaac
gagctgcgcggccgctatgtcgacaccagccgcagcaatttccagatgaccatggacatc
tcggtcttctctttcacggcggtggcaaaccgcgctgagaagatgatgagcgagggcggc
tcgctgctgaccctgacctattacggtgccgagcaggtgatgccgcactataatgtgatg
ggtgtggccaaggccgcactggaagcttcggtcaaatacctggccgaggatctgggcaag
gacggcatccgcgtcaacgcgatctcggccggcccgatcaagaccctggccgcctccggc
atcggcgatttccgctacattatgaagtggaacgaatacaattcgccgctgcgccgcaac
gtgaccactgatgacgtcggcaaatccgcgctttatcttctgtccgacctcagctccggc
gtgaccggcgagaacctgcatgtcgatgccggctatcacgtggtgggcatgaaggcggtg
gatgcaccggatatctccaagtaa

DBGET integrated database retrieval system