KEGG   Leisingera sp. NJS204: ETW24_10115Help
Entry
ETW24_10115       CDS       T05817                                 

Definition
(GenBank) molybdopterin molybdenumtransferase MoeA
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00790  Folate biosynthesis
lej01100  Metabolic pathways
Module
lej_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:lej00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETW24_10115
Enzymes [BR:lej01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     ETW24_10115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C
Motif
Other DBs
NCBI-ProteinID: QAX29691
UniProt: A0A481PM85
LinkDB All DBs
Position
2057642..2058817
Genome map
AA seq 391 aa AA seqDB search
MIPVSEARAHLLTLVQQLETEQVPLAQAAGRVLAADLQARRDQPPFSASAMDGYAVNAAE
VEQHAMFKVIGEAAAGHAFQGRAGAGQAVRIFTGAPVPEGASFVVIQEDTTRNGDLITIT
GAPGSNHNIRPRGGDFTDGQTVTAPKRLTPADIALLAAMNIPAIPVTRRPEIALISTGDE
LVMPGGTPGPDQIIASNTFGLKAMLEDLGARARILPIARDTESSLRTAFELAEGADLVVT
IGGASVGDHDLVGKVAQDLGMERSFYRVAMRPGKPLMAGRMNGAAMVGLPGNPVSAMVCG
HVFLAPMVRSMLGLPAPSQQHLLTAVLCAPLTANGPREHYMRANVQSGQLQAFDNQDSSL
LTILAEANALLVRPPKDGARSVGDIVQYLPI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggtcagcgaagcccgcgcgcatcttttaacgcttgttcaacagcttgaaacc
gaacaggtgccgctggcacaggccgcgggccgggtgctggcggctgatctgcaagcgcgc
cgtgatcagccgccgttctccgcctcagcaatggacggttacgctgtgaacgccgctgag
gttgagcagcacgccatgttcaaggtgatcggcgaagccgccgccggtcacgcatttcag
ggccgcgccggcgcgggccaggccgtgcgtatctttaccggtgcaccggtacctgaaggc
gcaagttttgttgttatacaagaagatacaacccgcaacggcgaccttatcaccatcacc
ggcgcccccggcagcaaccacaacatccgccctcgcggcggcgatttcaccgatggccag
accgtcacggcccccaagcgcctgacaccggctgacattgccttgctggcagccatgaac
atccccgcgatacccgtcacccgccgcccggagattgcactgatctccaccggcgacgaa
ttggtgatgcccggcggcaccccaggaccggaccagatcattgcctccaacacctttggc
ctcaaagcgatgctcgaagaccttggcgcccgtgcccgcatcctgcccatcgcccgtgac
accgaaagctcgctgcgcacggcctttgaactggccgagggcgctgatctggttgtcacc
atcggcggcgcctcggttggtgatcatgatctggtcggcaaggtggcgcaggatctcggg
atggagcgcagtttctacagggttgctatgcgccccggcaaaccgctgatggccggccgg
atgaatggcgctgctatggttggcctgcccggcaatccagtatcggccatggtctgcggc
cacgtgtttctggccccgatggtgcgatccatgctgggattgcctgcaccatcgcagcag
cacttgctgacggccgtcctttgcgcccccctgacggccaatggtccgcgcgagcactac
atgcgggcaaatgtgcaaagcggccagttgcaagcgtttgacaaccaggacagctccctg
ctcaccattttggccgaagccaacgccctgctggtccgcccccccaaggacggcgcgcgc
agcgtaggcgatattgtgcaatacttgccgatctaa

DBGET integrated database retrieval system