KEGG   Leisingera sp. NJS204: ETW24_13060Help
Entry
ETW24_13060       CDS       T05817                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00970  Aminoacyl-tRNA biosynthesis
lej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lej00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ETW24_13060 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lej03029]
    ETW24_13060 (gatB)
Enzymes [BR:lej01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ETW24_13060 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ETW24_13060 (gatB)
Mitochondrial biogenesis [BR:lej03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ETW24_13060 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey FimA
Motif
Other DBs
NCBI-ProteinID: QAX30216
UniProt: A0A481PM89
LinkDB All DBs
Position
2656441..2657952
Genome map
AA seq 503 aa AA seqDB search
MLDLTYELPKPKVIAGAKHDWELVIGMEVHAQVSSKSKLFSGASTKFGAEPNSNVAFVDA
AMPGMLPVINEYCIEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVELGDGTARNVRVERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRG
PEEAAAYIAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCLPGQYEKYQETQDFDHLGTRC
EIKNMNSMRFIQQAIEVEARRQIAIIEAGGKIDQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQAWVDDIAANLPELPDEKKARFIKDFGLSDYDASVLTAEVEAAAYFEE
TANGRNGKLAANWVINELFGRLKKEDHAISDSPVSPAQLGGIIDLISSDAISGKIAKDLF
EIVYTEGGDPAQIVEERGMKQVTDTGAIETALDEIIAANPAQVEKAKVNPKLAGWFVGQV
MKATGGKANPAAVNKLVAQKLGG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacctgacatatgaactccccaagcccaaggtgatcgcgggcgccaagcatgac
tgggaactggtcatcggcatggaggtgcatgcccaggtcagctccaagtccaagctgttc
tccggcgcctccaccaaattcggcgccgagccgaactccaatgtggcctttgtggacgca
gcaatgcccggcatgctgcccgtgatcaacgaatactgcattgaacaggcggtgcgcacc
gggctgggcctgaaggcggatatcaacctgtggtcggcctttgaccgcaagaattacttc
taccccgacctgccgcagggctaccagatttcacagctctaccaccccattgtgggtgag
ggcgaagtgctggtggaactgggcgacggcaccgcacgcaacgtgcgggtcgagcgcatc
cacatggagcaggacgcgggcaaatcgatccacgacatggatcccaacatgtcctttgtc
gacctgaaccggaccggcgtctgcctgatggagatcgtgtcgcgccccgacatccgcggg
ccggaagaagccgccgcctatatcgccaagctgcgccagatcatgcagtatctgggcacc
tgcgacggcaacatgcagaacggtaatctgcgcgccgacgtgaacgtttcggtctgcttg
ccgggccagtacgagaagtaccaggaaacccaggatttcgatcatctcggcacccgctgc
gagatcaagaacatgaactccatgcgcttcatccagcaggccatcgaagtcgaggcccgc
cgccagatcgccatcatcgaagcgggtggcaagatcgaccaggaaacccgcctgtatgat
ccggacaagggcgaaacccgctccatgcggtccaaggaagaagcgcatgattaccgctat
ttccccgaccccgacctgctgccgctggagatcgaacaagcctgggtcgatgacatcgcc
gccaatctgccggaactgccggacgagaaaaaggcgcgtttcatcaaagacttcggactt
agcgactatgacgcctcggtgctgaccgccgaggtcgaggccgcggcctactttgaagaa
accgccaatggccgcaacggcaagctggctgccaactgggtgatcaacgaactgttcggc
cgccttaagaaagaagatcacgccatcagcgattcgccggtttccccggcgcagctcggc
ggtatcattgatctgatttcctcggacgccatctcgggcaagatcgccaaggacctgttc
gagatcgtctataccgaaggtggcgaccctgcgcagatcgtcgaagagcgcggcatgaag
caggtgaccgacaccggcgccatcgaaaccgccctggacgaaatcatcgccgccaacccg
gcgcaggtggaaaaggccaaggtgaacccgaaactggcaggctggtttgtcggccaggtg
atgaaagccaccggcggcaaggccaacccggctgccgtgaacaagctggtggcccagaaa
ctgggcggctga

DBGET integrated database retrieval system