KEGG   Leisingera sp. NJS204: ETW24_13145Help
Entry
ETW24_13145       CDS       T05817                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00473  D-Alanine metabolism
lej00550  Peptidoglycan biosynthesis
lej01100  Metabolic pathways
lej01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lej00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ETW24_13145
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ETW24_13145
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ETW24_13145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lej01011]
    ETW24_13145
Enzymes [BR:lej01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ETW24_13145
Peptidoglycan biosynthesis and degradation proteins [BR:lej01011]
 Precursor biosynthesis
  Amino acid ligase
   ETW24_13145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: QAX30233
UniProt: A0A481PM29
LinkDB All DBs
Position
complement(2676912..2677832)
Genome map
AA seq 306 aa AA seqDB search
MSKSSRTLPKVAVLMGGPSAERDVSLSSGRECTVALRGEGFEVIEIDAGRDLHARLADIK
PDVVFNALHGRWGEDGCVQGVLEWLGLPYTHSGVLASALAMDKQRSKEVYRAAGLPVVES
GLFAKADVMAGHVMAPPYVVKPNNEGSSVGIYIVHEAANGPPLLSEQMPAEVMVETYAPG
RELTTTVVGDKALTVTDILTDGWYDYDAKYKPGGSRHVLPADLPREIHDLCLEYALKAHE
VLGCRGVSRTDFRWDEARGAGGLILLETNTQPGMTPTSLVPEQAAHLGMTFGELCAWMVE
DASCNR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagtcgagcaggacactcccgaaagtcgcggtgctgatgggtggcccgtcagcc
gaacgcgacgtatcgctgtccagcggccgtgaatgcacggttgctttgcgcggtgagggg
ttcgaggtcattgagattgatgcaggccgggacctgcacgcgcgtctggcggatatcaaa
ccggatgtggtgttcaacgcgttgcacgggcgctggggcgaggacggctgcgtgcagggc
gtgctggaatggctggggctgccctatacccattccggggtgctggcctcggcgctggca
atggacaagcagcgctccaaggaagtgtaccgcgccgccggcctgccggtcgtcgaaagc
gggctgtttgccaaggccgacgtgatggcgggccatgtgatggcgccgccctatgtggtg
aaacccaacaatgaaggctcaagtgttggcatctatatcgtgcatgaggccgccaacggc
ccgccgctgctgtcggagcagatgcctgccgaagtgatggttgaaacctacgcgccgggc
cgcgaactgaccaccaccgtggtgggggacaaggcgctgaccgtgaccgatattctaacc
gacggctggtatgattacgacgccaaatacaagccgggcggatcgcgccatgtgctgccc
gccgacctgccgcgggaaatccatgatctgtgcctggaatatgcgctgaaggcgcatgag
gtgctgggctgccgcggcgtgagccgcaccgatttccgctgggatgaggcgcgcggcgcc
ggcgggctgatcctgttggagaccaacacccagcccggaatgacgccgacctcgctggtg
ccggagcaggcagcacatctgggcatgacattcggcgaactctgcgcctggatggtggag
gatgcctcatgcaaccgctga

DBGET integrated database retrieval system