KEGG   Leisingera sp. NJS204: ETW24_16165Help
Entry
ETW24_16165       CDS       T05817                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00061  Fatty acid biosynthesis
lej00780  Biotin metabolism
lej01100  Metabolic pathways
lej01130  Biosynthesis of antibiotics
lej01212  Fatty acid metabolism
Module
lej_M00083  Fatty acid biosynthesis, elongation
lej_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:lej00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETW24_16165
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ETW24_16165
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ETW24_16165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lej01004]
    ETW24_16165
Enzymes [BR:lej01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ETW24_16165
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ETW24_16165
Lipid biosynthesis proteins [BR:lej01004]
 Fatty acid synthase
  Component type
   ETW24_16165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: QAX30777
UniProt: A0A481PPP0
LinkDB All DBs
Position
3322419..3323210
Genome map
AA seq 263 aa AA seqDB search
MAGLLTGKRGLIMGVANDRSIAWGIAKAMAEAGAELAFTYQGEAFGKRLEPLAQSVGSDF
MVDVDVTDDASLDTAFEQLGSRWPSIDFVVHAIAYSDKSELTGRFLDTSRANFKNSLDIS
AYSFIEVARRAHPLMKENGGTLLTLTYQGSNQVVPNYNVMGVAKAALESATRYLANDLGP
EGIRVNAISPGPMKTLAGAAIGGARKTFKHTAQNAPMRDNATLEAVGGTAVYLASDAGSC
TTGEVIRVDGGFHVLGMPQQDYL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgggactgctgaccggcaaacgcggcctgattatgggcgttgccaatgaccgctcc
atcgcctggggcattgccaaggccatggccgaagccggtgccgagctggcctttacctat
cagggcgaagcctttggcaagcggctggagccgctggcacagagcgtcggctcggacttt
atggtcgacgtggatgtgaccgacgacgcctcgcttgatacggcgttcgaacagcttggc
agccgctggccgtcgatcgatttcgtggtccatgcgattgcctattcggacaaatccgaa
ctgaccgggcggttcttggacaccagccgggcaaactttaagaactcgctggatatctcg
gcctattccttcatcgaagtggcgcgccgggcacatccgctgatgaaggaaaacggcggc
accctgctgacgctgacctatcagggatcaaaccaggtggtgccgaactacaatgtgatg
ggcgtggccaaggcagcgctggaatcggcgacccgctacctggccaatgacctgggcccc
gagggcatccgggtgaatgcaatttcgcccggtccgatgaagacactcgccggtgctgcc
atcggcggcgcgcgcaagaccttcaagcacacagcccagaatgcgccaatgcgtgacaac
gccacgctggaggcggtaggcggaaccgcagtataccttgcgtctgatgcaggctcttgc
acgaccggtgaagtcatccgggtcgatggcggcttccacgtgctgggaatgccgcagcag
gattatctgtaa

DBGET integrated database retrieval system