KEGG   Lodderomyces elongisporus: LELG_00333Help
Entry
LELG_00333        CDS       T01116                                 

Definition
(RefSeq) repressible alkaline phosphatase precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00730  Thiamine metabolism
lel00790  Folate biosynthesis
lel01100  Metabolic pathways
Module
lel_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LELG_00333
   00790 Folate biosynthesis
    LELG_00333
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LELG_00333
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LELG_00333
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lel00537]
 Enzymes
  LELG_00333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 5234749
NCBI-ProteinID: XP_001527813
UniProt: A5DSJ7
LinkDB All DBs
AA seq 565 aa AA seqDB search
MVKSENYPLLGGDSLRCTNKSPASIAKRLSIILNIITIITIAYLYFYHNTNTDSDKHSGS
HKHGHGKFHQLLHHHPRSKKNVIMMVTDGMGPASVSAARSFRQFRDKLPINDVLTIDQYF
IGTSRTRSSSSLVTDSAAGATAFSCALKSYNGAIGVDPKKNPCGTILEALKLQGYMTGLV
VTTRITDATPAAFSSHADYRFQEDLIAQHQIGEYPLGRVVDLILGGGRCHFLPTSVPGGC
RADARNLIDETRKLGWSYVGNRSEFDALQGGKNVTLPLLGLLADTDIPYDIDRDPKEYPS
LAEEVEVALTALSEATKDSDQGFFLLIEGSRIDHAGHHNDPAAQVREVLAYDKAFAKVIE
FINTSDVETVAISTSDHETGGMVTARQVTENYPDYLWYPEVLLNSSHSGEYLAQKIYEKR
NQKSHELKKFIREEILKSDMGVEADSAHDDIIDEIVSKASNPNELLYVLNNIISFQAQIG
WTTHGHSAVDVNIYAHTNSEQILHRLKSHKHGLFGNHENIEIGAFMESLTGSDLKNVTKL
IKDTTHAPGKSDVFIDEYHGHIVPQ
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaatctgaaaattatcctctattaggaggcgactcgcttcgatgcacaaacaag
tcacctgcaagcatcgcgaaacgactctctatcattttgaacatcatcaccataatcact
atagcatatctctacttttaccacaatacaaacacagattcagacaagcatagtggcagc
cacaaacatggacatggcaagtttcatcaactacttcatcatcatcctcgctctaagaaa
aatgttattatgatggttactgatggtatgggccctgccagtgtctcggctgctcgctca
ttccgtcaatttagagacaaattacccatcaacgacgtattaacaattgaccaatacttt
attggaacttcaaggacgcggtcatcgagctcgttggtgacagattctgctgctggtgcc
accgctttttcatgtgctttgaaatcgtataatggagcaattggtgtagaccccaagaaa
aacccatgcggcaccatactcgaagcattgaagttgcaaggttacatgactgggttggtg
gtgacaacgcggattaccgatgcaacaccagctgctttttcatcgcatgcagattaccga
ttccaagaagatttgattgctcaacaccaaattggggaatatccattgggcagagttgtt
gacttgattttgggtggcggaagatgccatttcttgcctactagcgttccaggtggatgc
agagctgacgcaagaaacttgattgatgagactcgcaaactgggttggtcttatgttggc
aacagaagtgagtttgacgcattgcaaggtggtaagaatgtaaccttgccattgttggga
ttacttgctgatacagacataccatatgatattgatagggatcctaaagaatacccatct
ttggcagaagaggttgaagttgcattaactgcattatcagaagctacaaaggactcagac
caagggtttttcttattgattgaaggttcgagaattgaccatgctggacatcataatgac
cctgcagcacaggtgagggaggtattggcatacgacaaggcatttgccaaggttattgag
tttattaatacttcagatgtcgaaacagtggcaatttcaactagtgaccatgagactggc
ggaatggtgactgcaagacaagtcactgagaattatcctgactacttatggtaccccgaa
gtgttactaaacagctctcactcgggagagtacttggcccagaagatttacgaaaagcgt
aatcaaaaaagccacgaattgaaaaagtttattagagaggagattttgaaatcagatatg
ggagtagaagcggactctgcgcatgacgacatcattgatgagattgtctccaaggcatcc
aaccccaatgaactactctatgtgttgaacaatatcatttcgttccaggcacaaattgga
tggacgacacatggacattctgctgttgatgtcaatatttatgcacatacaaactctgag
caaatcttgcacaggttgaagtcacacaagcatggtctctttggaaaccatgaaaacatt
gagattggggcgtttatggagtcattgaccggttctgatttgaagaatgtgacaaagttg
ataaaggataccacacatgctccaggtaaatctgatgtgtttatcgatgaatatcatggg
catatcgtgccacagtaa

DBGET integrated database retrieval system