KEGG   Lodderomyces elongisporus: LELG_01308Help
Entry
LELG_01308        CDS       T01116                                 

Definition
(RefSeq) elongation of fatty acids protein 3
  KO
K10246  fatty acid elongase 3 [EC:2.3.1.199]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00062  Fatty acid elongation
lel01040  Biosynthesis of unsaturated fatty acids
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01212  Fatty acid metabolism
Module
lel_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    LELG_01308
   01040 Biosynthesis of unsaturated fatty acids
    LELG_01308
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lel01004]
    LELG_01308
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     LELG_01308
Lipid biosynthesis proteins [BR:lel01004]
 Elongase
  LCFA
   LELG_01308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 5235049
NCBI-ProteinID: XP_001528788
UniProt: A5DVC2
LinkDB All DBs
AA seq 335 aa AA seqDB search
MSFISESSAKDLIQISLPSIERPFGIYLWPIFNKVFELVIGYPADDFEFIYHKTFLANGF
HAVSIIVVYYIIIFGGRSLINKFRLPALKLNFLFQLHNIVLTLLSLSLLLLCIEQLVPII
YKHGLFYAICSKGAFTQKLVTLYYLNYLTKYLELVDTVFLVLKKKKLLFLHTYHHGATAL
LCYTQLTGYTSVEWVPITLNLAVHVVMYWYYFLSARGIRVWWKEWVTRFQIIQFILDLGF
VYFATYTHYAFRYFPSLPCMGDCHGSELAAAYGYLILSSYLVLFISFYIKVYKTKGGDAA
SKKAAGVDKSRDAATDGAKTSGVETSQSKVKSRKV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcatttcagaaagttccgctaaggacttgatccaaatcagtttaccatccatc
gaacgtccgtttggaatttatctctggccaattttcaacaaggtgtttgaactggtgatt
ggatacccagccgacgatttcgagtttatttaccacaagactttccttgccaatgggttc
catgcggttagtattattgttgtttactatatcattatctttggtggtcgttccttgatc
aacaagtttaggttgccagcattaaagctcaatttccttttccaattgcacaatattgtg
cttacattgttgtcgttgagtttgttattgttgtgtattgagcagttggtgcccattatt
tacaagcatggtttgttttatgctatttgttccaaaggtgcatttacccagaagttggtg
acattgtactatttgaactatttgaccaagtatttggaacttgttgatactgtttttctt
gtgttgaagaagaagaagttgttgtttctccacacttatcaccatggtgccacggcgttg
ttgtgttacacacagttaactggttacacttcagttgagtgggttccaatcaccttgaat
ttggctgtgcatgttgttatgtactggtactatttccttagtgccaggggtattagagtt
tggtggaaggagtgggtgacccgtttccaaattattcagtttattttggacttgggtttt
gtgtactttgctacatacacacactatgcgttccgttatttcccatctttgccatgtatg
ggagactgtcatggaagtgagttggctgctgcatatggatacttgattttgtcgagttac
ttggtgttgtttattagtttttacatcaaggtgtacaagaccaagggtggcgatgcagct
tcaaagaaggcggccggtgtcgataagagtagggatgcagcaactgatggtgcaaagacc
tctggtgttgaaacatcacaatctaaagtgaaatcaagaaaagtataa

DBGET integrated database retrieval system