KEGG   Lodderomyces elongisporus: LELG_01770Help
Entry
LELG_01770        CDS       T01116                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00020  Citrate cycle (TCA cycle)
lel00190  Oxidative phosphorylation
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
Module
lel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lel_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LELG_01770
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LELG_01770
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LELG_01770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA Ran_BP1 FAD_binding_3 HI0933_like DAO FKBP_N_2
Motif
Other DBs
NCBI-GeneID: 5233866
NCBI-ProteinID: XP_001526941
UniProt: A5DWN3
LinkDB All DBs
AA seq 639 aa AA seqDB search
MSFTSTFAEHGVRRLFSTSPQRLRILGSKIKGQETNLQKVNNQLRYKIIDHEYDCVVVGA
GGAGLRAAFGLASEGYKTACISKLFPTRSHTVAAQGGINAALGNMHKDDWHWHMYDTVKG
SDWLGDQDAIHYMTREAPVSIYELEQYGVPFSRNEEGRIYQRAFGGQSKEYGKGGQAYRT
CAVADRTGHALLHSLYGQSLRHDCHFYIEFFAMDLLMQDGECVGVIAYNQEDGTLHRFRA
HKTIVATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFIQFHPSGIYGSGCLITE
GARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEINEGRGVGPEKDHMYLQLH
HLPPAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTKWNGEVIKKNANGE
DEVVPGLLACGEVACASVHGANRLGANSLLDLVVFGRAVSHTIRDSLKPGTPLKPMDYSL
GKESIENLHKLRTANGNRSTAEIRLEMQKTMQKGCAVFRTQDTLDICVQHINEVDKQFVN
VKTTDRSMIWNSDLVETMELQNLLTCATQTAASAAARKESRGAHAREDYPERDDVNWWKH
SLSYQLHSGAPVKLDYRDVVKTTLDENECKPVPPTVRAY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcacatccacatttgcagaacatggggttcgtcgactattctcaacgagtcca
cagcgactaagaattttgggatccaaaattaaaggacaagagacaaatctccagaaagta
aataatcaactcaggtacaaaatcattgaccatgagtatgactgtgtcgttgtcggagcc
ggcggagcaggtttgagagcagcttttggtttagcctccgaaggatacaagactgcatgt
atatcaaagctatttccaacaagatcgcacacagttgcagcccaaggtggaattaatgca
gcattgggcaatatgcacaaagatgattggcattggcatatgtatgatacagtgaaggga
tctgattggcttggtgatcaggacgcaatccactatatgacaagagaggcgccagtctct
atttacgaacttgaacaatacggtgtgccgttttcgagaaatgaggaaggaagaatttac
caaagagcgtttggtggacaatcaaaagaatatggtaaaggtggccaggcatataggaca
tgtgctgttgcagacaggactggacatgcattattgcattctctttatggtcagtcattg
agacatgattgtcatttctatattgagttttttgcaatggatttgttgatgcaagatgga
gaatgtgttggagtaattgcatataatcaagaagatgggactttgcatagatttagagca
cacaagaccattgttgcgactggtgggtatggcagagcttatttttcttgtacatcggca
catacgtgtactggagatgggtatgcaatggtctcgagagcagggttgccgttggaagat
ttagagtttatacagttccacccatctggaatatatggttctggatgcttaatcacggaa
ggtgctagaggcgaaggtggtttcttggtcaattcagaaggtgaacggtttatggaaaga
tacgcacccacggccaaggatttggcttgcagagatgttgtttcaagagccattactatg
gagattaacgaagggcgaggtgttggccctgaaaaggaccatatgtatttgcaactccac
caccttccaccagcggtattgaaagaaaggttacccggtatttccgagacggcacatatt
tttgctggtgttgatgttacaaaagaacccatacctattttaccaactgtacattacaac
atgggtggtatcccaacgaaatggaatggagaagtgattaaaaaaaatgcaaatggagaa
gacgaggttgttccagggctcttggcttgcggtgaagttgcgtgtgcatcagtacatggt
gccaacagattaggtgctaattcgttattagatttagtggtatttgggagagcagtttca
cataccattcgtgattcattaaagcccggaactccattgaaaccaatggattactcgttg
ggaaaagagtcaatagaaaatctacacaagttgcgaactgccaatggaaatagatcgact
gcagagattagactagaaatgcaaaagacaatgcaaaagggctgtgcagtatttagaacc
caggatactttagatatttgcgttcaacacattaatgaagtagataagcaatttgtcaat
gtgaaaacaaccgataggtccatgatatggaatagcgatttggtagagactatggagttg
caaaatcttctcacatgtgctacccaaactgcagcatcagcagcagcaaggaaggagtca
agaggtgctcacgcccgtgaagattatcctgaaagagatgatgtcaactggtggaagcat
tcactttcgtaccagctgcactctggtgctccagtaaaattggactacagagatgttgtc
aagaccacattagacgaaaatgagtgtaagccggttcctccaacagttagggcgtactga

DBGET integrated database retrieval system