KEGG   Lodderomyces elongisporus: LELG_02084Help
Entry
LELG_02084        CDS       T01116                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00500  Starch and sucrose metabolism
lel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LELG_02084
Enzymes [BR:lel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LELG_02084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 5234493
NCBI-ProteinID: XP_001527255
UniProt: A5DXJ7
LinkDB All DBs
AA seq 622 aa AA seqDB search
MLVSYLALCVTIVLVMNAAAILIPFDDLTGLSGKYQQWLDLFLKPSTDIFQNTISYFKST
SNDDVLLQPSFSSSHQPKAQFDFSQFESWLENQQNISLYRILDNVIASPSTSKIINDNRK
NKRNKKNDVVKNVLVASPSRNSPDYFYQWIRDSAITIKTLMYALQENPEHELNTTILDVV
HSYVCNNWHLQRTKNPLGGFDMNSGDNKGLGEPKFNVDGLAFEQNWGRPQRDGPALRTLA
NFQYLRFLEENVGNFDMATPWICETSGGDTYGDTNDDTDGGQGVFNGTWVYHEIIRPDLN
YIIQYWNRTDGFDLWEEMTTPHFFTLMVLIRAVRDAVYWALHFNDVDLAETLQSAYDAMK
IGITRDTASGGLGFINSEVDYLVEHPELYNLGQRTGLDIATILAVMYTHEHDGHPEQNSH
PSLNNAIRDIPFNATNHKILNSLAHLVVDMQQRFPINKQFHFIRGSGVALGRYPEDVYDG
VQTSVGNPWFLATSAAGELVYQFIYGIVENDADLVINKENRAFFLPFLSTDSEKQIDDNV
KLVFASQEYNLMIQKLKQYADSFLAVVKFHTDSEGHLSEQFNRNNGYMQGAKDLTWSYGA
LWTAVRWRTKTLNLLNNKGLNV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgttggttagctatttagctttatgtgttacaatcgtgctggtcatgaatgcggctgca
atcctgattcccttcgatgacttgacgggtctttcaggaaagtatcaacaatggcttgat
ttgtttctcaaaccatccacagacatctttcaaaacaccatttcgtacttcaaatccaca
agtaatgatgatgttttacttcaaccgtcattctcaagttcacaccagcctaaagcacag
tttgatttttctcaattcgaatcatggcttgagaatcaacaaaacatttcgttatatcgg
attttagacaatgtaattgcgtcaccatcgacctcaaagatcattaacgataacaggaaa
aacaaaagaaacaaaaagaacgatgttgtaaaaaacgtactagttgcttctccttcaaga
aactcaccagattacttttatcaatggatccgtgactccgccattacaataaagacactc
atgtatgctcttcaagagaatcctgagcacgaactcaacacaactatcttggatgttgtt
cattcatatgtttgcaacaactggcatttgcaacgtacaaaaaacccactgggcggattt
gacatgaattcgggtgataataaagggcttggcgaaccaaaattcaatgtcgatggactg
gcatttgaacaaaattggggtcgcccacaacgagatggcccagcactacgtacattagcc
aattttcaataccttcgatttctcgaagaaaatgtaggaaactttgacatggcaacccct
tggatttgtgaaacaagtggaggtgacacttatggcgacactaatgacgacactgatggt
ggtcaaggtgtttttaatggaacatgggtttatcatgagatcatcaggccggacttgaac
tacatcattcaatactggaatcggactgatgggtttgatctatgggaagaaatgacaact
cctcattttttcactttaatggtactgattcgcgctgtgcgcgatgcagtatattgggca
ttacatttcaatgacgttgatcttgctgaaacactccaatcagcatatgatgcaatgaaa
attggtattacaagagatacggcaagcggcggacttgggtttataaactctgaagtggac
tatttagtcgagcacccggaattatacaacctggggcagaggacggggttggacattgca
acaatattggcagtcatgtatacccacgagcacgatggtcatcctgagcaaaattcacac
ccatcactcaataatgccataagagacattccttttaatgctaccaatcacaagattctc
aattcgcttgcacatttggtagtagatatgcaacaaagattccccataaataaacaattt
catttcattcgtggaagtggagtggccttgggaagatacccagaagatgtttatgatgga
gtgcaaacgtcagtaggcaatccgtggtttcttgctacatcagccgccggggaactcgtg
tatcagttcatctatggaattgtggaaaatgatgctgatttggtaattaacaaggaaaat
cgcgcattttttcttcctttcctctcaacagattcggaaaagcagatagatgacaatgta
aagttagtctttgcaagccaagagtataaccttatgattcaaaaacttaagcaatatgca
gattcatttcttgcagtagtgaaattccatacggattcagaggggcatttgagtgaacaa
tttaatcgcaataacggatacatgcaaggtgctaaggatctaacatggagctatggtgct
ttatggactgcagttcgatggagaacaaagacattaaatttgttgaacaataaaggactc
aatgtatag

DBGET integrated database retrieval system