KEGG   Lodderomyces elongisporus: LELG_02126Help
Entry
LELG_02126        CDS       T01116                                 

Definition
(RefSeq) DNA ligase I, mitochondrial precursor
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lel  Lodderomyces elongisporus
Pathway
lel03030  DNA replication
lel03410  Base excision repair
lel03420  Nucleotide excision repair
lel03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LELG_02126
   03410 Base excision repair
    LELG_02126
   03420 Nucleotide excision repair
    LELG_02126
   03430 Mismatch repair
    LELG_02126
Enzymes [BR:lel01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LELG_02126
    6.5.1.6  DNA ligase (ATP or NAD+)
     LELG_02126
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     LELG_02126
DNA replication proteins [BR:lel03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    LELG_02126
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     LELG_02126
DNA repair and recombination proteins [BR:lel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LELG_02126
   NER (nucleotide excision repair)
    Other NER factors
     LELG_02126
   MMR (mismatch exicision repair)
    Other MMR factors
     LELG_02126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase EFG_II Roughex Presenilin
Motif
Other DBs
NCBI-GeneID: 5234261
NCBI-ProteinID: XP_001527297
UniProt: A5DXN9
LinkDB All DBs
AA seq 786 aa AA seqDB search
MHLLRRNLIKTEKLVKLKCLGCLKNTTMAQQQTLGRFFGSSASIQASKPKAKAKAEKTTT
SPTKSAPIKLTKRANSLDKNGDVTSSLSAKKRKVTASNQDYEDANLSLNNDRSSQENNSE
EMDSEMTTENNEKEKEEAKSLIKLSEEQQKNKTQGSENQKSLATAKIPYSLLTDIFESIE
HESSRLKITAIISQFFLEILQQQQQEGDVSKLVKIVYLFINRLGPDYEPDLELGLGETLL
IKAISECYGRTPTKIKQDYKEVGDLGLVAQKSRSGQPTMFKSADLDVDTVFENLTKIAKS
TGKDSQLKKIGIINKMLTACQLKHNEAKFLIRSLEGKLRIGLAEKTVLVGLAQAFVNFEA
WKNNGNNKRIDPAKLVEAEDTMREAFTRIPNYQVLIENAYKYGIFNLLDHSQLTPGIPLK
PMLAKPTKSMSEVLDRFQDEKFTCEYKYDGERAQVHLSSDGQVRIYSRNSEDMSQRYPDL
ISIIKEFSKTQEHTSMILDCEAVAWDRVQKKILPFQVLSTRKRKDVNEKDITVFICLFAF
DILYYNNTSLITKSLKERREIMFKHLTPIEGKFQFATSKDSTSLEVLQQFLDQSVKDSCE
GLMVKMLEGTESYYEPSKRSRNWLKLKKDYLEGVGDSLDLVVIGAYSGRGKRTGTYGGFL
LASYNQDTGDLETTCKIGTGFSEEDLAKLYERLHPTEIPKAKEYFVYDKTNSNAVPDVWF
EPSVLFEVLTADLSLSPIYKAAHSEYGKGISLRFPRFLRLRDDKDIEDATSSTQVSEFYQ
RQAHLL
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgctcaggaggaacttgataaaaactgagaaacttgtaaagctcaaatgttta
gggtgtttgaagaatacaaccatggcacagcagcaaactttaggacgattttttggctcg
agtgcatcgatacaagcctcaaaaccgaaagcaaaagcaaaagcagaaaaaaccactaca
tcgcccactaaatcagcaccaatcaaactcacaaagagagccaattccttggacaagaat
ggtgatgttacctccagtctatcggccaagaaacgaaaagtgactgcaagtaatcaggat
tatgaggatgcaaacttgtcgcttaacaatgaccgttccagtcaagaaaataattcggaa
gagatggacagtgaaatgactacagaaaacaatgaaaaggaaaaagaagaagcaaagtct
ttgattaagttgagtgaggaacaacaaaagaataaaactcaaggatccgagaatcaaaaa
tcacttgcaacagcaaagatcccatactctttattaacggacatttttgagtctatcgaa
cacgaatcatctaggttgaaaatcaccgcgattatatcgcagttctttcttgagattttg
cagcagcagcagcaagaaggagatgtttccaaattggtcaaaattgtttatctattcatc
aacaggttgggtccagactatgaacctgatttagaattgggccttggagaaaccttgttg
attaaagccattagtgagtgttacggcagaaccccaacaaaaatcaaacaagactacaag
gaggttggagatttgggtctagtggcacagaaatctagatctggtcaaccaacgatgttc
aaatctgcagatttggatgtggacacagtatttgaaaacttgaccaagatcgccaagtct
accggaaaagattcgcaactgaaaaagattggaatcatcaacaagatgttgactgcgtgt
caattaaagcacaatgaagccaaatttctcatccgctcattggaaggtaaactaaggatt
gggttggccgagaaaactgtgctcgttggattagcgcaagcatttgttaattttgaagct
tggaaaaacaatggaaacaataaaagaattgaccctgcaaaacttgtagaggccgaagat
actatgcgtgaggcatttacacggatcccaaattaccaggtacttatcgaaaacgcatac
aagtacggcatttttaatttacttgaccatagtcagcttaccccgggcataccattgaaa
cctatgttggcaaaaccaacaaaatcaatgagtgaagttttagatagatttcaagatgaa
aagttcacttgtgaatacaagtatgacggagaaagggctcaagtgcatttgtcttctgat
ggccaagtacggatctattcgagaaactcagaggacatgtcgcagaggtatcctgattta
atttcaattatcaaagagtttagcaaaactcaagaacatacctcaatgattttggattgc
gaggctgttgcttgggatagagttcagaaaaagattttgccattccaagtcttatctaca
agaaagaggaaagatgtgaatgagaaagacattaccgttttcatctgcttatttgcattt
gatatcttgtattacaacaacacatcattaatcacaaagtctctcaaagagagacgcgaa
attatgtttaagcatttgactcctatcgaaggtaagtttcagtttgcaacatcaaaggac
tctacctcactagaggttttgcaacaattcttagatcaaagtgtcaaagactcgtgtgaa
ggtttgatggtgaagatgctagagggtactgaatcatattatgaaccctcaaaaagatct
agaaactggttaaagttgaagaaagattacctcgagggtgttggagactccttggatctt
gtggttattggtgcatatagtgggcgtggtaaacgaacaggaacatatggtgggtttttg
ttggcttcatacaaccaagatactggggatttggagacaacatgtaaaataggtacaggg
ttcagcgaggaggacttggcaaaactatatgagagattacaccccaccgagatccccaag
gcaaaggaatactttgtttatgacaagacaaattcaaatgccgtgccggatgtatggttt
gagcctagtgtactatttgaagttttaactgctgatttgtcgttaagtcctatatacaag
gcagcgcatagtgaatatggtaagggaatatcattgaggtttcctagattcttacgtctt
cgtgacgacaaagatatagaagatgcaaccagctctacccaggtgagtgaattttaccag
cgtcaagcccacctcctgtaa

DBGET integrated database retrieval system