KEGG   Lodderomyces elongisporus: LELG_03126Help
Entry
LELG_03126        CDS       T01116                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00010  Glycolysis / Gluconeogenesis
lel00051  Fructose and mannose metabolism
lel00052  Galactose metabolism
lel00500  Starch and sucrose metabolism
lel00520  Amino sugar and nucleotide sugar metabolism
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
Module
lel_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lel_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_03126
   00051 Fructose and mannose metabolism
    LELG_03126
   00052 Galactose metabolism
    LELG_03126
   00500 Starch and sucrose metabolism
    LELG_03126
   00520 Amino sugar and nucleotide sugar metabolism
    LELG_03126
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LELG_03126
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     LELG_03126
Membrane trafficking [BR:lel04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    LELG_03126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 5232371
NCBI-ProteinID: XP_001525198
UniProt: A5E0I9
LinkDB All DBs
AA seq 485 aa AA seqDB search
MVHLGPKPPQHRKGSFTDVSPQLMEELNELEKQFTVSGETLRKIVDHFITELDKGLSKAG
GNIPMIPGWVMDFPTGKETGDYLAIDLGGTNLRVVLVKLGGNRDFDTTQSKFPLPSNMRT
ATSEELWSFIANCLKTFFEEEFPNGVEEPLPLGFTFSYPASQNTITQGVLQRWTKGWAIE
GVEGHDVVPMLQSAIEKVQVPVKIVAVINDTVGTLVASNYTDPEAKLGLIFGTGVNGAYY
DVVGDIPKLEGKLESDIGVDSPMAINCEYGSFDNEKFILPRNKYDVMIDEESPRPGQQTF
EKMNSGYYLGEILRLVLVDLAENKKVIFKNQDLTKLNEVYILDTSFPAKIEEDPFENLSD
VQEIFQSVLGLETTVPERKVIRRIAELIGNRSARLSVCGIAAICKKRGYKTAHCAADGSV
YSKYPDFKQRAAQSLRDIFEWSDDVKEDPILIVDAEDGSGVGAAIIAALTEKRLKEGKSV
GIKGA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttgggtccaaaaccaccacaacatagaaaaggttccttcaccgatgtctca
ccacaacttatggaggaactcaatgagcttgaaaagcaattcactgtttcaggcgaaact
ttgcgtaaaattgtcgaccacttcatcactgaattggacaagggtctttccaaggctggc
ggtaacattcccatgatcccaggttgggtgatggacttccctacaggtaaggagactggt
gattacttggctattgatcttggtggaaccaaccttcgagttgtgttggtgaaacttggt
ggaaatagagatttcgacactactcaatcgaagttccccttgccttctaatatgagaaca
gctaccagcgaggaattgtggtcctttattgccaactgtttaaagactttttttgaagaa
gagtttccaaatggagttgaagaaccattgccattgggcttcacattcagttatcctgct
agtcaaaatacaatcacacaaggtgtcttgcaaagatggactaaaggatgggccatcgaa
ggtgttgagggtcacgatgtggtcccaatgttgcaatctgcaattgagaaagttcaagtt
ccagtcaagattgttgccgtgatcaatgatactgtgggtacattagttgcttcaaactac
actgaccctgaagcaaaattgggtcttatttttggtactggtgttaatggtgcatactat
gacgttgttggcgatattcctaaattggagggcaagcttgaaagtgatattggagtagac
tctccaatggccatcaactgtgaatatggatcatttgataacgagaagttcattttgcca
agaaacaagtacgatgtgatgatcgatgaagagtcaccaagaccaggacagcaaacattt
gaaaagatgaattctggttactacctcggtgaaattttgagattggttcttgtcgacttg
gctgagaacaaaaaagttattttcaaaaaccaagacttgaccaagttgaacgaagtgtac
attcttgacacttcattcccagcaaagattgaagaagatccatttgagaacctttcggat
gtgcaagagattttccaaagcgtcttgggtctcgagacgactgttccagaacgtaaagtt
atccgccgtattgcagagttgattggaaacagatccgccagattgtcagtttgtggtatt
gctgctatctgtaagaagagaggatacaagactgcccactgtgctgccgatggatcagtt
tactcgaaataccctgactttaagcaaagagctgcccaaagtttgagagatatctttgag
tggtcagacgatgtgaaggaagatcctattttgattgtagatgcagaggatggaagtggt
gttggtgcagccattattgctgcattgactgaaaagagattgaaggagggaaaatccgtt
ggtattaagggtgcttga

DBGET integrated database retrieval system