KEGG   Lodderomyces elongisporus: LELG_05728Help
Entry
LELG_05728        CDS       T01116                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00020  Citrate cycle (TCA cycle)
lel00190  Oxidative phosphorylation
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
Module
lel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lel_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LELG_05728
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LELG_05728
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LELG_05728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 5230202
NCBI-ProteinID: XP_001523182
UniProt: A5E7Y9
LinkDB All DBs
AA seq 640 aa AA seqDB search
MLSSLRNQVRATRLAKQFSTTSIRSQVIGSNVKGQDFNAAKLMGQKYHVVDHEYDCLVVG
AGGAGLRAAFGLASEGYKTACVSKLFPTRSHTVAAQGGINAALGNMHKDDWHWHFYDTVK
GSDWLGDQDAIHYMTKEAPASIYELENYGVPFSRNEEGRIYQRAFGGQSKEFGKGGQAYR
TCAVADRTGHALLHSLYGQSLRHDCHFFIEFFAMDLMMQDGACIGIVAYNEEDGTLHRFF
ANRTVIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFVQFHPSGIYGSGCLIT
EGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRAITMEINEGRGVGPEKDHMYLQL
SHIPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNWQGEVLKKNADG
QDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVSHTIAGNLKPGQPIPQHEKD
IGYESIANLDKLRNANGTKSTADIRLDMQKTMQKGCAVFRTQETLDQCVEHIGQVDADFA
NVKTTDRSMIWNSDLVETLELQNLLTCATQTAASAAARKESRGAHARDDYPDRDDVNWRK
HTLSYQDGFGAPVRLDYRDVVKHTLDDNDCKPVPPAKRVY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcctcacttcgtaatcaagttagggccacgagacttgctaagcaattctccacc
acatcgataagatcccaggtcattggttccaatgtcaagggtcaagatttcaacgctgca
aagctcatgggtcaaaagtaccatgttgtcgaccacgagtatgactgtcttgttgtcggt
gccggtggtgctggtttgagagcagcttttggtttggcctctgaaggttacaagaccgca
tgtgtctcaaagttgttccccaccagatcccacactgttgctgctcaaggtggtatcaat
gccgctttgggtaacatgcacaaggatgactggcactggcatttctacgatactgtgaaa
ggttcagattggttgggtgatcaagatgccattcactacatgaccaaagaagctcctgcc
tcgatttacgagttggagaactatggtgttccattctcaagaaacgaagaaggaagaatc
taccaaagagcatttggtggtcaatccaaggagtttggtaaaggtggtcaagcttataga
acatgtgctgttgccgacagaaccggtcacgcattgttgcactccctttacggtcaatca
ttgagacacgattgtcactttttcattgagttctttgccatggacttgatgatgcaagat
ggtgcttgtattggtatcgttgcatacaatgaagaagatggtactttgcacagattcttt
gccaacagaaccgttattgccactggtggatacggtagagcctacttttcatgtacctct
gcacacacatgtaccggtgatggttacgccatggtttctagagctggtttgccattggaa
gatttggaatttgtccaattccacccatctggtatttatggttctggatgtcttattact
gaaggtgctagaggtgaaggtggtttcttggttaactctgaaggtgagagatttatggaa
cgttatgctccatcggccaaggatttggcttcaagagatgttgtctcaagagccatcacc
atggaaatcaacgaaggtagaggtgttggtccagaaaaagaccacatgtacttgcaattg
tctcacattccagccgctgtgttgaaggaaagattgccaggtatctctgagactgctcac
attttcgctggtgttgatgtcaccaaagagccaattccaatcttgccaaccgtgcactac
aatatgggtggtatcccaaccaactggcaaggtgaagtgttgaagaagaatgctgatggt
caagatgaagttgtaccaggtcttttggcttgtggtgaagctgcttgtgcttctgtccac
ggtgccaacagattgggtgccaactccttgttggacttggttgtgtttggaagagctgtt
tcccacaccattgccggtaacttgaaaccaggtcaaccaatcccacaacacgaaaaggat
attggttacgaatcgattgctaacttggacaagttgagaaacgctaacggaaccaagtca
actgctgatattagattggacatgcaaaagactatgcaaaagggatgtgctgttttcaga
actcaagagactttggaccaatgtgttgaacacattggacaagttgatgctgatttcgcc
aatgtcaagaccactgaccgttcaatgatttggaacagtgatttggttgagactttggaa
ttgcaaaacttgttgacttgtgctacccagactgctgcctctgctgctgctagaaaggag
tctagaggtgcccacgctagagacgattacccagacagagacgatgtaaactggagaaag
cacactttgtcataccaagacggatttggagcaccagtcaggttggactacagagatgtt
gttaagcacactttggacgacaatgactgtaaaccagtgccaccagcaaagcgtgtgtac
tag

DBGET integrated database retrieval system