KEGG   Lodderomyces elongisporus: LELG_05799Help
Entry
LELG_05799        CDS       T01116                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial precursor
  KO
K02358  elongation factor Tu
Organism
lel  Lodderomyces elongisporus
Brite
KEGG Orthology (KO) [BR:lel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lel03012]
    LELG_05799
   03029 Mitochondrial biogenesis [BR:lel03029]
    LELG_05799
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lel04147]
    LELG_05799
Translation factors [BR:lel03012]
 Eukaryotic Type
  Elongation factors
   LELG_05799
 Prokaryotic Type
   LELG_05799
Mitochondrial biogenesis [BR:lel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LELG_05799
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LELG_05799
  Exosomal proteins of breast cancer cells
   LELG_05799
  Exosomal proteins of colorectal cancer cells
   LELG_05799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 5236000
NCBI-ProteinID: XP_001528804
UniProt: A5H2T4
LinkDB All DBs
AA seq 422 aa AA seqDB search
MFQRIQSLLPRRLALTSRPLLTRGYAAYNRTKPHVNIGTIGHVDHGKTTLTAAITKVLAE
KGYANFLDYGSIDRAPEERARGITISAAHVEYETDKRHYAHSDLPGHSDYIKNMITGASQ
MDGAIIVVAATDGQMPQTREHMLLARQVGIQNLVVYVNKVDTIDDPEMLELVEMEMRELL
SHYGFDGENTPVIMGSALCALEGKKPEIGVESINKLLDAVDEYIPTPERDADQPFLMPVE
DVFSISGRGTVVTGRVERGSLKKGEEVEIVGESSFKATSTGIEMFKKELDAAIAGDNCGI
LLRGVKRDEVKRGMVLAKPGTLKSHKKFLASIYVLTTEEGGRKTPFGEGYKPQLFFRTSD
ITADFSFPEGEGVDHSRMVMPGDNVEMVGTLIKLAPLELNQRFNIREGGKTVGTGMVTRI
IE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaagaattcaaagtctcttgccaagacgtttggcacttacctcccgtcctttg
ttgactagaggatacgctgcctacaaccgtaccaagccacacgttaacattggtactatt
ggtcacgttgatcatggtaaaaccaccttgactgctgccatcaccaaggttttggctgaa
aaaggttacgccaacttcttggactatggttcaattgatagagctccagaagaaagagca
agaggtatcaccatctctgctgctcacgttgagtacgaaaccgacaagagacactatgcc
cactctgatttgccaggtcactccgattatattaagaacatgattactggtgcctcccaa
atggacggtgctattattgttgttgctgccaccgatggtcaaatgccgcaaaccagagaa
cacatgttgttggctagacaagttggtatccaaaacttggttgtttatgttaacaaggtt
gacaccattgatgacccagagatgttggaattggttgaaatggaaatgagagaattgttg
tcgcactatggatttgacggtgaaaacaccccagtcattatgggttctgctttgtgcgct
ctcgaaggtaagaagccagaaattggtgttgagtccatcaacaagttgttggatgctgtt
gacgaatacattcctaccccagaaagagatgctgaccaaccattcttgatgccagttgaa
gatgtcttttccatttccggtagaggtactgttgttaccggtagagtcgagagaggttca
ttgaagaagggtgaagaagttgagattgttggtgaatccagcttcaaggctacttcaacc
ggtattgaaatgttcaagaaggaattggacgctgctattgctggtgacaactgtggtatc
ttgttgagaggtgtcaagagagacgaagtcaagagaggtatggttttggccaagccaggt
actttgaagtcccacaagaaattcttggcatcgatctatgtcttgaccactgaagaaggt
ggtcgtaagactccattcggtgaaggttacaagccacaattgttctttagaacctccgac
atcactgctgactttagcttcccagaaggtgaaggtgttgaccactctagaatggttatg
ccaggtgacaatgtcgagatggttggtactttgatcaaattggcaccattggagttgaac
caacgtttcaacatcagagaaggtggtaagactgttggtaccggtatggttaccagaatc
atcgagtaa

DBGET integrated database retrieval system