KEGG   Lysobacter enzymogenes M497-1: LEN_1927Help
Entry
LEN_1927          CDS       T04598                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lem  Lysobacter enzymogenes M497-1
Pathway
lem00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LEN_1927
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lem02000]
    LEN_1927
Enzymes [BR:lem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LEN_1927
Transporters [BR:lem02000]
 Other Transporters
  Pores ion channels [TC:1]
   LEN_1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: BAV97414
UniProt: A0A1J1EDK3
LinkDB All DBs
Position
2274251..2274928
Genome map
AA seq 225 aa AA seqDB search
MIKVHHLNNSRSQRVLWLLEELELPYEVIRYQRDPKTMLAPPELRAIHPLGKSPVVELDG
QVLAESAAIIETLCERYDSGHTVSPPPQPLDGEERRRYRYWMHYAEGSAMPPLLLSLVFA
RIRSAPMPFFAKPVARGIADKAMRAFVGPQLALHLGYIESELGQREWFAGDRFTAADIQM
SFPVEAATARAIGERPRMQAFVERIRARPAYQRALEKGGPYSLLS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtccaccacctcaacaattcccgctcccagcgcgtgctgtggctgctggag
gagctggaactgccttacgaggtgatccgctaccagcgcgatcccaagacgatgctggcg
ccgccggagctgcgcgcgatccatcccctgggcaagtcgccggtggtggagctggacggg
caggtgctggccgagtcggcggcgatcatcgagaccttgtgcgagcgctacgacagcggc
cacacggtttcgccgccgccgcagccgctggacggcgaggagcgccggcgttaccgctac
tggatgcactacgccgagggctcggcgatgccgccgctgctgctgagcctggtgttcgcg
cggatccgctcggcgccgatgccgttcttcgccaagccggtggcgcgcgggatcgctgac
aaggccatgcgcgccttcgtcgggccgcagctggcgctgcacctgggctatatcgaaagc
gagctgggccagcgcgaatggttcgccggcgatcgcttcaccgcggccgatatccagatg
agcttcccggtcgaggccgcgaccgcgcgcgccatcggcgagcggccgcgcatgcaggcc
ttcgtcgaacgcatccgcgcgcggccggcgtaccagcgggcgttggagaagggcgggccg
tattcgttgttgagttga

DBGET integrated database retrieval system