KEGG   Lysobacter enzymogenes M497-1: LEN_3391Help
Entry
LEN_3391          CDS       T04598                                 

Definition
(GenBank) dipeptidyl carboxypeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lem  Lysobacter enzymogenes M497-1
Brite
KEGG Orthology (KO) [BR:lem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lem01002]
    LEN_3391
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lem04147]
    LEN_3391
   04090 CD Molecules [BR:lem04090]
    LEN_3391
Enzymes [BR:lem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LEN_3391
Peptidases [BR:lem01002]
 Metallo Peptidases
  Family M2
   LEN_3391
Exosome [BR:lem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LEN_3391
CD molecules [BR:lem04090]
 Proteins
  LEN_3391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 YkuD
Motif
Other DBs
NCBI-ProteinID: BAV98878
UniProt: A0A1J1EHC8
LinkDB All DBs
Position
4214939..4216975
Genome map
AA seq 678 aa AA seqDB search
MKPVRALLALGVAAAVFGLAGCKKEPAPAPSANAPAAAPAGETADQFIARVNDEYKKMYP
EMTAAQWLSSTYINDDSQLLSAKANERYLGQLNNWIEQSKKFEGQPMSPATARAIQLLKI
GTAMPAPKDPAKLAELTQIATRMEGMYGSGSFCSGPGDTDCRQLGELEDVLRNSRDYNAQ
LDAWKGWHTISKPMRKDYTRFVELVNEGSRNLGYADTGELWRSGYDMSPAELSAETDRLW
GQVKPLYEQLHCYTRSRLETKYGNDKGQVAGGLLPAHLLGNMWQQDWGNLWDVLAPYSEQ
QAGSLDINAALARQYQQALDAQQAKGGGEGASAAQQAQVEVDASLANAKRMTERAQDFYV
SLGMPKLPDSYWAKTQFVKPRDRDVVCHASAWDMNMSGDVRTKMCIKPNEEDFTTIYHEL
GHVYYYLAYNKQPPLFQTGAHDGFHEAIGDTIVLAMTPKYLSSIGMVANPQQSQEALINA
QMRMALAKVSFLPFGLMIDRWRWGVFDGSIKPDQYNKAWWELKAKYQGVAPVEARGEEFF
DAGAKYHVPGNTPYTRYFLSHVLQFQFYKALCDAAGYKGPLYECSFYGNKAAGAKFEAML
SKGASQPWQQTMKELTGGEKMDASAVLEYFAPLQTWLKQQNEGKSCGWQASAAGAAAPVS
PAAKPAAKSEAPAKPAKG
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtccgcgccttattggcgctcggcgtcgctgcggccgtgttcggcctggcc
ggctgcaagaaggaacccgcccccgccccgagcgccaacgccccggccgccgcgccggcc
ggcgagaccgcggaccagttcatcgcccgggtcaacgacgaatacaagaagatgtatccg
gagatgaccgcggcgcagtggctgtcgtcgacctacatcaacgacgacagccagttgctc
tcggccaaggccaacgagcgctacctcggccagctcaacaactggatcgagcagtccaag
aagttcgaaggccagccgatgtcgccggccaccgcgcgcgcgatccagttgctcaagatc
ggcaccgcgatgccggcgccgaaggatccggccaagctcgccgagctgacccagatcgcc
acccgcatggaaggcatgtacggttcgggcagcttctgcagcggccctggcgacaccgat
tgccgccagctcggcgaactggaagacgtgctgcgcaacagccgcgactacaacgcccag
ctcgacgcctggaagggctggcacaccatctccaagccgatgcgcaaggactacacgcgc
ttcgtcgaactggtcaacgaaggctcgcgcaatctgggctacgccgacaccggcgagctg
tggcgttcgggctacgacatgagcccggcggagctgtcggccgagaccgaccgcctgtgg
ggccaggtcaagccgctgtacgagcagctgcactgctacacccgttcgcgcctggaaacc
aagtacggcaacgacaagggccaggtcgccggcggcctgttgccggcgcatctgctcggc
aacatgtggcagcaggactggggcaacctgtgggacgtgctggcgccgtacagcgagcag
caggccggcagcctcgacatcaacgccgcgctcgcgcgccagtaccaacaggcgctcgac
gcgcagcaggccaagggcggcggcgaaggcgccagcgccgcgcagcaggcgcaggtcgaa
gtcgacgcctcgctggccaacgccaagcgcatgaccgagcgcgcgcaggacttctacgtc
tcgctgggcatgcccaagctgcctgacagctattgggccaagacccagttcgtcaagccg
cgcgaccgcgacgtggtctgccacgccagcgcctgggacatgaacatgagcggcgacgtg
cgcaccaagatgtgcatcaagccgaacgaagaagacttcaccacgatctaccacgagctc
ggccacgtctattactacctggcctacaacaagcagccgccgctgttccagaccggcgcg
cacgacggcttccacgaagccatcggcgacaccatcgtgctggcgatgacgcccaagtac
ctatcgtcgatcggcatggtcgccaacccgcagcagagccaggaagcgctgatcaacgcg
cagatgcgcatggccctggccaaggtctcgttcctgccgttcggcctaatgatcgaccgc
tggcgctggggcgtgttcgacggctcgatcaagcccgaccagtacaacaaggcgtggtgg
gaactgaaggccaagtaccagggcgtggcgccggtggaagcgcgcggcgaagagttcttc
gacgccggcgccaagtaccacgtgccgggcaacaccccgtacacgcgctacttcctctcg
catgtgctgcagttccagttctacaaggcgctgtgcgacgcggccggctacaagggcccg
ctgtacgagtgcagcttctacggcaacaaggccgccggcgccaagttcgaggcgatgctg
agcaagggcgcgagccagccgtggcagcagaccatgaaggaactcaccggcggcgagaag
atggacgcctcggcggtgctggaatacttcgcgccgctgcagacctggctcaagcagcag
aacgaaggcaagagctgcggttggcaagcctcggcggcgggcgctgcggcgccggtgtcg
ccggcggccaagcctgcggcgaagagcgaggcgccggccaagcccgccaagggctga

DBGET integrated database retrieval system