KEGG   Leptolyngbya sp. NIES-3755: LEP3755_20700Help
Entry
LEP3755_20700     CDS       T04199                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
len  Leptolyngbya sp. NIES-3755
Brite
Enzymes [BR:len01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LEP3755_20700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAU11571
UniProt: A0A0S3U273
LinkDB All DBs
Position
complement(2168518..2169117)
Genome map
AA seq 199 aa AA seqDB search
MAFTQAPLPFAKDALESYGMKAETFDYHYGKHHAAYVANLNKLVEGTEMENLALEDVIKQ
SYGDSSKTGVFNNAAQVWNHTFFWNSLKAGGGGAPTGELAAKIDAAFGSFDKFKEEFSNA
AATQFGSGWAWLVDDGGTLKVTKTPNAENPLVHGQKPLLTLDVWEHAYYLDFQNARPAFI
KNYLENLVNWDFVAQNLAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacacaagcgcctttaccttttgcgaaagatgcccttgaatcgtatggcatg
aaggcggaaacgttcgattatcactacggcaaacatcacgctgcttatgtcgccaacttg
aacaagctggtggaaggcactgagatggaaaatctggcactcgaagacgtgatcaaacag
tcgtatggcgattcgtcgaagactggcgttttcaacaatgcggcacaggtttggaatcat
actttcttttggaactcgctcaaagcgggtggcggtggtgcaccgaccggagaattagca
gcgaagattgatgcggcttttggaagctttgacaagttcaaagaagaattcagtaatgcg
gcagccactcagtttgggagcggttgggcatggcttgtcgatgatggcggtacgctaaaa
gtgacgaagactccgaatgcagaaaatccgctggttcatggtcaaaaacccctgttaacg
ctggatgtttgggaacatgcttactatctggatttccaaaatgctcgtccagcattcatc
aagaactatttggagaatttggtgaactgggattttgtggctcagaatttagccgcgtaa

DBGET integrated database retrieval system