KEGG   Leptolyngbya sp. NIES-3755: LEP3755_21130Help
Entry
LEP3755_21130     CDS       T04199                                 

Definition
(GenBank) glucan 1,4-alpha-maltohexaosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
len00500  Starch and sucrose metabolism
len01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:len00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LEP3755_21130
Enzymes [BR:len01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LEP3755_21130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: BAU11614
UniProt: A0A0S3U2A1
LinkDB All DBs
Position
2212884..2214362
Genome map
AA seq 492 aa AA seqDB search
MSEPNGVMMQYFHWYLPSDGTFWNELAEKSEELAQAGITSLWLPPAYKGVGGGYEVGYGV
YDMYDLGEFDQKGSVRTKYGTKDEYIKAVKAAQAAGMRVYADVVFNHRMGADQEEVVEAT
PLSQDNREEVIGEYKPVKAWTHFTFPGRDGKYSKMEWHWWHFDAIDYNEYEKQQQAVYLL
KGKEFDDNVDLEKGNFDFLMGCDLDMSHPEVCEELKRWGEWYYDTTGVDGFRFDAAKHVT
APFFHDWLEHMRNYGQRELFSVAEYWSYEVEALHYFIEATQGKVAVFDAPLHYNFHVASR
AGNSYDMRQIFDNTIVQQQPCLAVTMVDNHDSQPLQSLESPVESWFKPLAYALILLRCEG
YPCIFHPDYYGACYRDYGGDGNEHEIWLDSHRWLIDKFLYARRDYAYGDQYNYFDHPNVV
GWTRLGDEAHPGGMAVVLSNGEGGSKWMEVGQCDRTYIDITEHVKEPVTTNEHGWGEFRC
NGGSVSVWVPQN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgaatggcgtgatgatgcagtactttcattggtacttgccgagcgatgga
acattctggaatgagcttgcagaaaagtctgaagagctagcacaagcgggtatcacgtcg
ctttggttgccccctgcttacaaaggggttggtggcggctatgaggtcggatacggcgtt
tatgatatgtacgacttgggggaatttgatcagaaaggttcagttcgcaccaagtacggc
acgaaagacgaatatattaaagcggtcaaagcggctcaggcagcaggaatgagggtctat
gcagatgtggtatttaatcaccgcatgggtgcagaccaagaagaagtggttgaagccact
ccactcagccaggacaatcgggaagaagtgatcggagaatacaagcctgtgaaagcttgg
acacatttcacctttccgggacgcgatggcaagtactccaaaatggaatggcattggtgg
cattttgatgcgatcgactacaacgagtacgagaagcaacagcaagccgtctacctgctc
aaaggtaaagaatttgatgacaacgtagacctagagaaagggaacttcgatttcctcatg
ggttgcgatctcgatatgagccatccggaagtctgcgaagaactgaagcgctggggtgaa
tggtactacgacaccacgggtgtagatggtttccggtttgatgcggcgaaacatgttacg
gctcccttcttccatgattggttggagcacatgcggaactatggtcagcgagaactgttc
tcggttgcagagtattggtcgtatgaagtggaagcattgcactatttcatcgaggcgact
caaggaaaagtagccgtgtttgatgcacccttgcactacaatttccatgtcgctagtcgg
gcgggaaatagctatgatatgcgccagattttcgataatacgatcgtgcaacagcaacct
tgtctcgccgtcacaatggtcgataaccatgactctcagccattgcagtcgttagaatct
ccagttgaatcttggttcaagcctttagcttatgcgttgattctcttacggtgtgaaggt
tatccttgcatcttccatcccgactactatggtgcttgctaccgggactatggtggagat
ggcaatgaacatgagatttggcttgatagtcatcgctggctgattgataagttcttgtat
gcgcgacgtgactatgcttacggcgatcaatacaactattttgatcatccgaatgtggtg
ggttggacccgcttgggagatgaagcgcatccgggtggaatggcagttgtgctgagtaat
ggagaggggggaagtaaatggatggaagtgggacagtgcgatcgcacttacatcgatatt
actgagcatgtgaaagaacccgtcaccacgaacgaacacggctggggtgaattccgctgt
aatggtggctctgtctcggtttgggttccacagaactaa

DBGET integrated database retrieval system