KEGG   Leptolyngbya sp. NIES-3755: LEP3755_33540Help
Entry
LEP3755_33540     CDS       T04199                                 

Definition
(GenBank) amidase, putative
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
len00970  Aminoacyl-tRNA biosynthesis
len01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:len00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LEP3755_33540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:len03029]
    LEP3755_33540
Enzymes [BR:len01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LEP3755_33540
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LEP3755_33540
Mitochondrial biogenesis [BR:len03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LEP3755_33540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAU12823
UniProt: A0A0S3U5V0
LinkDB All DBs
Position
3449212..3450660
Genome map
AA seq 482 aa AA seqDB search
MASIRELHQQLIGKERSAVEIVQESLNQIQALEPKLHSFLQVTNDRALEFAKQIDAKIAA
GDEIGLLAGIPIAIKDNLCTQGVPTTCASKILQNFVPPYESTVTQKLIDAGAVMVGKTNL
DEFAMGGSSETSAFAKTANPWDTSRVPGGSSGGSAAAVAGGECPIALGSDTGGSIRQPAS
FCGIVGMKPTYGLVSRYGLVAFASSLDQIGPFARSTEDAAILLNAIAGYDSKDSTSLKVE
VPDYTQFLASDLKGKRVGIIKETFGEGLDPEVEKAVMSAIDQLKALGAEVKEISCPRFRY
GIAAYYIIAPSEASANLARYDGVKYGARIEDAENLMEMYTKTRSEGFGAEVKRRIMIGTY
ALSAGYYDAYYLKAQKVRTLIKQDFEAAFEQVDVLVSPTAPTTAFKLGDKSQDPLSMYLI
DLMTIPVNLAGLPGMSVPCGFDSQGLPIGLQIIGNVLREDQVFQVASAYERSTDWHTRVP
KL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcatccattcgcgagttgcatcaacaactcatcggcaaagaacgatcggcagttgaa
attgtgcaagagtcgctcaatcagattcaggcacttgaaccgaaactgcacagttttttg
caggtgacgaacgatcgcgctttggaattcgccaaacaaattgatgccaaaattgccgca
ggagatgagattggattactcgccggaattccgatcgcgattaaagataatctctgcacc
caaggcgttccgaccacttgcgcctcgaaaattctgcaaaactttgtgccaccgtatgaa
tcgactgtgactcagaaattgatcgatgcgggcgcggtgatggttggcaaaacgaatctt
gatgaattcgcgatgggcggatcgtccgagacttctgcgttcgcgaaaacggcgaatcct
tgggatacgtcacgggttccgggcggatcgtctgggggatcggcagcggcagttgcgggg
ggagaatgtccgatcgcactcgggtctgatacgggtggatcgattcgtcaacctgcttcg
ttctgcggaattgtgggaatgaagccgacttatggactggtttcgcggtatggattggtc
gcgtttgcgtcgtcgttggatcagattggtccgtttgctcgatcgacggaagatgccgcg
attttgttaaatgcgatcgcaggatacgattcaaaagattccacgagcctgaaagtcgaa
gttcccgattacacgcagtttctcgcgtctgatctcaaaggaaagcgagttggcatcatc
aaagaaacgttcggcgaagggcttgatccagaagttgaaaaagcggtgatgagcgcgatc
gaccaacttaaagccttgggagccgaagttaaggaaatctcctgtcctcgattccgctat
ggaattgcagcgtattacatcattgcaccgtcggaagcttctgcgaatttggcgcggtat
gacggggtgaaatatggagcaagaatcgaagatgctgagaacttgatggagatgtatacg
aaaacgcgatcggaaggattcggagcggaagtcaaacgccggatcatgatcggaacgtat
gcgctatcggctggatattatgatgcgtattatttgaaggcgcagaaggtgagaacgctg
attaagcaagactttgaagcggcattcgagcaagttgatgtattagtttcaccgactgca
ccgacaaccgcatttaagttaggcgataagtctcaagatccgctgagtatgtatctgatc
gatttgatgacgattccggttaacttggcgggattgccaggaatgagtgtgccgtgtgga
tttgattcgcagggtttaccgatcgggctgcaaattatcggcaacgtattacgcgaggat
caagttttccaggtcgcatcggcgtatgagcgatcgaccgattggcatacgcgggttccg
aagctttag

DBGET integrated database retrieval system