KEGG   Leptolyngbya sp. NIES-3755: LEP3755_41050Help
Entry
LEP3755_41050     CDS       T04199                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
len00500  Starch and sucrose metabolism
len01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:len00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LEP3755_41050
Enzymes [BR:len01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LEP3755_41050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: BAU13565
UniProt: A0A0S3U7Z0
LinkDB All DBs
Position
4157147..4158472
Genome map
AA seq 441 aa AA seqDB search
MPNVTLHAFNWRYTDIIENLESIRKAGYGAILIPPLLYSDPKGDQWWQRYQPKDYRVLLS
HLGGKRDLERLIEACHSGSSRIQVYADLVINHMANEARDDRLNFPGEAELANYKAEPALF
EENRLYGDLSEGLFSPWDFNQAGEIEGGEWSDRGAVQYQNLSGLPDLKDSDWVLKQQHLM
VQALVEMGFDGFRIDAIKHLTEHMIDSLADTAAFRELFWFGEVLTGSDQDEAIFLDPFLR
ETWISAYDFPLFQTIREAFSFGGSLRSLSNPESQKNALPWNRAVTFVVNHDIPHNDGFRS
WLLDPQDEHLAYAYLLGRDGGVPLIYSDHNESKYSSDRDRWLDVYKRPDLVSMIQFHNAV
HGQPMQVVFESDVLLVFRRGDKGIVAINKSSENQWAEFSTWGLKNPGKYRDLIHPHEINL
SGNTFSLWVPPRTAQMWLATS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatgtaactctccacgcttttaactggcgctatacggatattatcgaaaacctg
gaatcgattcgtaaggctggatacggtgcaatcttgattccgccactgctttattctgat
ccaaaaggcgatcaatggtggcaacgctatcaacccaaagactatcgagtgttgttgtcg
catctgggcggcaaacgcgatctggaacgattgatcgaagcctgtcacagtgggagttcc
agaattcaagtgtatgccgatctcgtgatcaatcacatggcaaatgaagccagagacgat
cgccttaatttccccggtgaagctgaactcgcaaactacaaagctgaacctgcattattt
gaagaaaatcgattgtatggtgatttgagtgaaggcttgttttcgccgtgggacttcaat
caagcaggagaaatcgaaggcggcgaatggagcgatcgaggagccgttcaataccaaaat
ctctcaggactgcccgacctcaaagattcagactgggtgctaaaacaacagcatttaatg
gtgcaagctttagtcgaaatgggatttgatggattccgaattgacgcgatcaaacatcta
accgagcacatgatcgatagtcttgccgatactgcggcatttcgggaattgttctggttt
ggcgaagttttgactggaagcgatcaagacgaagcaattttcctcgatcctttcctgcgc
gaaacttggatatccgcttacgatttccccttattccaaacgattcgcgaagcctttagc
tttggtggctcgcttcgatcgttatccaatcccgaatctcaaaagaatgcgcttccctgg
aatcgagccgttacgtttgtggttaatcatgatattccgcataatgacggctttcgatcg
tggttgctcgatccccaagacgaacatttagcttatgcgtatctcttgggtcgagatggt
ggagtgccattgatctactcggatcacaacgaatcaaaatattcatccgatcgcgatcgc
tggctggatgtctacaagcgtccggatctcgtttcgatgattcaattccacaacgccgtt
cacggacaaccgatgcaagttgtatttgagagtgatgtcttgctcgtttttcgacgcggg
gacaaaggaatcgttgcgattaacaaaagtagtgaaaatcagtgggcagaattcagcaca
tggggcttaaagaatccaggaaaataccgcgatctgattcatccgcatgaaatcaattta
tctggaaacaccttctctctctgggttccgcctcgtactgctcaaatgtggttagccact
tcctga

DBGET integrated database retrieval system