KEGG   Leptolyngbya sp. NIES-3755: LEP3755_47980
Entry
LEP3755_47980     CDS       T04199                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
len00010  Glycolysis / Gluconeogenesis
len00020  Citrate cycle (TCA cycle)
len00620  Pyruvate metabolism
len01100  Metabolic pathways
len01110  Biosynthesis of secondary metabolites
len01120  Microbial metabolism in diverse environments
len01200  Carbon metabolism
Module
len_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:len00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEP3755_47980
   00020 Citrate cycle (TCA cycle)
    LEP3755_47980
   00620 Pyruvate metabolism
    LEP3755_47980
Enzymes [BR:len01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LEP3755_47980
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H MadL
Other DBs
NCBI-ProteinID: BAU14252
UniProt: A0A0S3U9N3
LinkDB
Position
complement(4823341..4824624)
AA seq 427 aa
MIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLATIV
TQAGESAPVGSAIALLAETEAEIELAKQQAASTSAPADTPATPAAAPEPVAVAASPNGTS
TAPKNGRIVASPRARKLAKDLKVELSALAGSGPHGRIVAEDVEAAAGKTVSKPPVPAAPR
PAAPAPVAAATSRPAAPAPTPTQPGQIQPMTTLQTAVVRNMMASLDVPVFRVGYTMTTDA
LDKLYKQVKSKGVTMTALLAKAVAVTLQKHPLLYSSYVENGIHFNTGINIAVAVAMEDGG
LITPVLKNADQQDLYSLSRNWKDLVDRARSKQLQPDEYSSGTFTISNLGMFGVDTFDAIL
PPGQGSILAIGASRANVVANDEGMLGVRRQMQVNITCDHRIIYGADAAGFLRDLAKLIET
NAQSLTL
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgatccacgaaattttcatgcctgctctcagttccacgatgaccgaaggaaaaatcgtg
tcctgggtcaaatcaccgggcgacaaagttgaaaaaggcgaaaccgtcgtggtggtggaa
tcggataaagccgatatggatgtggaatcattctacgaaggctacctcgccacgatcgtc
actcaagcgggtgaatccgctcctgttggaagtgcgatcgcgcttttggctgaaaccgaa
gccgaaatcgaactcgccaaacaacaagctgcttcaacttctgcccccgctgatacccct
gccacacctgctgccgctcccgaacctgttgccgtcgctgcttcaccgaatggaacgagc
acggctccaaaaaatggtcgaattgtggcttctcctcgtgcccgcaaactggcaaaagat
ttgaaggttgaactttccgctctggctggtagcggtcctcacggtcgcattgtggcagaa
gatgtggaagctgcggcaggaaaaactgtctctaaaccacctgttcccgctgctcctaga
cctgctgcgcctgctccggttgccgctgctacttctagacctgctgcccccgctcccact
cccacccaacccggtcaaatccaaccgatgaccacgctccaaactgccgttgtgcggaac
atgatggcgagcttggatgttcctgtgttccgagtgggttatacgatgactacggatgcc
ctggacaaactctacaagcaggtgaaatcgaaaggcgtaacgatgacggcgctacttgcg
aaagcggtggcagtgacgttacaaaaacatccattgctgtattcgagttatgttgagaat
ggcattcacttcaatacaggaatcaacattgcggttgcggttgcgatggaagatggggga
ttgatcacgcctgtattgaaaaatgcagatcaacaagatttgtattcgctgtctcgcaat
tggaaagatttagtcgatcgagcacgatcaaaacaactccaacccgacgaatacagttct
ggaacctttacgatttctaacttgggaatgttcggagtcgatacgtttgacgcaattttg
ccaccgggacagggatcgattttagcgatcggggcttctcgtgcgaatgtcgtggcaaac
gatgagggaatgttgggggttcgtcgccaaatgcaggtgaatatcacttgcgatcatcgg
attatttatggagcagacgcggctggattcttgcgagatctagcgaaattgattgaaacg
aatgctcaatctctgacgctgtag

DBGET integrated database retrieval system