KEGG   Leptolyngbya sp. NIES-3755: LEP3755_47980Help
Entry
LEP3755_47980     CDS       T04199                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
len00010  Glycolysis / Gluconeogenesis
len00020  Citrate cycle (TCA cycle)
len00620  Pyruvate metabolism
len01100  Metabolic pathways
len01110  Biosynthesis of secondary metabolites
len01120  Microbial metabolism in diverse environments
len01130  Biosynthesis of antibiotics
len01200  Carbon metabolism
Module
len_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:len00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEP3755_47980
   00020 Citrate cycle (TCA cycle)
    LEP3755_47980
   00620 Pyruvate metabolism
    LEP3755_47980
Enzymes [BR:len01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LEP3755_47980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAU14252
UniProt: A0A0S3U9N3
LinkDB All DBs
Position
complement(4823341..4824624)
Genome map
AA seq 427 aa AA seqDB search
MIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLATIV
TQAGESAPVGSAIALLAETEAEIELAKQQAASTSAPADTPATPAAAPEPVAVAASPNGTS
TAPKNGRIVASPRARKLAKDLKVELSALAGSGPHGRIVAEDVEAAAGKTVSKPPVPAAPR
PAAPAPVAAATSRPAAPAPTPTQPGQIQPMTTLQTAVVRNMMASLDVPVFRVGYTMTTDA
LDKLYKQVKSKGVTMTALLAKAVAVTLQKHPLLYSSYVENGIHFNTGINIAVAVAMEDGG
LITPVLKNADQQDLYSLSRNWKDLVDRARSKQLQPDEYSSGTFTISNLGMFGVDTFDAIL
PPGQGSILAIGASRANVVANDEGMLGVRRQMQVNITCDHRIIYGADAAGFLRDLAKLIET
NAQSLTL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaaattttcatgcctgctctcagttccacgatgaccgaaggaaaaatcgtg
tcctgggtcaaatcaccgggcgacaaagttgaaaaaggcgaaaccgtcgtggtggtggaa
tcggataaagccgatatggatgtggaatcattctacgaaggctacctcgccacgatcgtc
actcaagcgggtgaatccgctcctgttggaagtgcgatcgcgcttttggctgaaaccgaa
gccgaaatcgaactcgccaaacaacaagctgcttcaacttctgcccccgctgatacccct
gccacacctgctgccgctcccgaacctgttgccgtcgctgcttcaccgaatggaacgagc
acggctccaaaaaatggtcgaattgtggcttctcctcgtgcccgcaaactggcaaaagat
ttgaaggttgaactttccgctctggctggtagcggtcctcacggtcgcattgtggcagaa
gatgtggaagctgcggcaggaaaaactgtctctaaaccacctgttcccgctgctcctaga
cctgctgcgcctgctccggttgccgctgctacttctagacctgctgcccccgctcccact
cccacccaacccggtcaaatccaaccgatgaccacgctccaaactgccgttgtgcggaac
atgatggcgagcttggatgttcctgtgttccgagtgggttatacgatgactacggatgcc
ctggacaaactctacaagcaggtgaaatcgaaaggcgtaacgatgacggcgctacttgcg
aaagcggtggcagtgacgttacaaaaacatccattgctgtattcgagttatgttgagaat
ggcattcacttcaatacaggaatcaacattgcggttgcggttgcgatggaagatggggga
ttgatcacgcctgtattgaaaaatgcagatcaacaagatttgtattcgctgtctcgcaat
tggaaagatttagtcgatcgagcacgatcaaaacaactccaacccgacgaatacagttct
ggaacctttacgatttctaacttgggaatgttcggagtcgatacgtttgacgcaattttg
ccaccgggacagggatcgattttagcgatcggggcttctcgtgcgaatgtcgtggcaaac
gatgagggaatgttgggggttcgtcgccaaatgcaggtgaatatcacttgcgatcatcgg
attatttatggagcagacgcggctggattcttgcgagatctagcgaaattgattgaaacg
aatgctcaatctctgacgctgtag

DBGET integrated database retrieval system