KEGG   Leptotrichia sp. oral taxon 212: AMK43_02730Help
Entry
AMK43_02730       CDS       T04044                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
leo  Leptotrichia sp. oral taxon 212
Pathway
leo00010  Glycolysis / Gluconeogenesis
leo00020  Citrate cycle (TCA cycle)
leo00620  Pyruvate metabolism
leo01100  Metabolic pathways
leo01110  Biosynthesis of secondary metabolites
leo01120  Microbial metabolism in diverse environments
leo01130  Biosynthesis of antibiotics
leo01200  Carbon metabolism
Module
leo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:leo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMK43_02730
   00020 Citrate cycle (TCA cycle)
    AMK43_02730
   00620 Pyruvate metabolism
    AMK43_02730
Enzymes [BR:leo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMK43_02730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CAT
Motif
Other DBs
NCBI-ProteinID: ALA95096
UniProt: A0A0K2JA31
LinkDB All DBs
Position
571076..572110
Genome map
AA seq 344 aa AA seqDB search
MENDKLRATPAARNLAKKLGVDLFKVQGSGAKGRVHKEDVEIFNYEKRIHISPLAAKIAK
EYDINLENVIGSGHNGKIMRDDILKLIAKPQEKEELIRHEVAKVVETKQINESDIEMIPM
SPMRKVIAKRMSESYFTAPTFTLNYEIDMTETKALRAKILDIIFEKTGKKVTITDIISLA
VIRTLMKHKYVNSSLTEDGNQIILHNYVNLAIAVGMDDGLLVPVIKNADKMTLSELVVKS
KEIVSKALEMKLSPTEQSGSTFTISNLGMYGVQSFNPVINQPNSAILGVSGMIDKPVAVN
GEIVIRPIMTLCLTIDHRVVDGLAGAKFMQDLKNLLENPISMLV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgataaattgagagccacacctgctgcaagaaatctagctaaaaagcttgga
gtggatcttttcaaagttcagggcagtggagctaaaggcagggttcacaaagaagatgta
gaaatttttaattatgaaaaaagaattcacatatcaccgcttgccgccaaaatagctaaa
gaatatgatattaatcttgaaaatgtaattggtagtggacataatggcaaaataatgaga
gatgatatattgaagctaattgcaaaacctcaggaaaaagaggaacttataagacatgaa
gtggcaaaagttgttgaaacgaagcagattaatgaaagtgatatagaaatgatacccatg
tctcctatgagaaaagtgattgccaagagaatgtctgaaagttattttacagccccaaca
tttacattgaattatgaaatagatatgactgaaacaaaagctctgagagcaaaaatttta
gatataatatttgaaaaaacaggaaagaaagtgactattacagatattatatcactcgca
gttataaggacattaatgaaacataaatatgtaaattcaagtctgacagaagatggtaac
caaattattttacacaattatgtgaacttggcaatagctgtaggaatggatgacggtctt
cttgttcctgtaataaaaaatgcggataaaatgactttgtctgaattagttgtaaaatct
aaggaaatagtatctaaagcacttgaaatgaaactttctcctactgaacagtcaggaagt
acatttactataagtaacttaggaatgtatggagttcagagttttaaccctgttataaat
caacctaactcagcaatattaggagtttcagggatgatagacaaaccggtagctgtaaac
ggagaaattgtcataagacctattatgactttgtgtctaacaattgatcacagagtagtt
gatggacttgcaggtgcaaaatttatgcaggatttgaaaaatctattggaaaatcctata
tcaatgttagtataa

DBGET integrated database retrieval system