KEGG   Leptotrichia sp. oral taxon 212: AMK43_08715Help
Entry
AMK43_08715       CDS       T04044                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
leo  Leptotrichia sp. oral taxon 212
Pathway
leo00500  Starch and sucrose metabolism
leo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:leo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMK43_08715
Enzymes [BR:leo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMK43_08715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ALA96076
UniProt: A0A0K2JCU5
LinkDB All DBs
Position
complement(1896655..1898103)
Genome map
AA seq 482 aa AA seqDB search
MENGVMIQYFEWNLPDDGKHWERLKNDAKHLSEIGVSAVWIPPAYKGTSSMDVGYGAYDL
WDLGEFDQKGSVRTKYGTKQELTEAIDELHKYGINVYLDVVLNHKAGADETERFMVIEVA
SDNRNEEVTEPYEIEGWTKFTFPGRNDRYSAFKWNYNLFTGVDFNNENQKTAIYKIVGEN
KDWAEEVDGEMGNYDYLMNADVNYAHPEVRKEVISWGKWVVNELKLDGFRMDAVKHISEG
FIKEFLDEVRNVYGQDFYSVGEYWKDDLETLKEYLESLEYTTDLFDVGLHFNFHEASVRG
KEFDLRTIFDNTILMSDSMQAVSFVDNHDSQKGSALESQIESWFKPHAYAIILLAERGYP
CLFYGDYYGVGGQESEHRWIIDQLLYVRKNYAYGGEIDYFDNPNIIGIYRTGRENELNTG
CIAVLSNNEEGEILIEAGQNRTGQVWKEVTGSGFENVVIDDNGFAAFKVRAGKISVWIPD
EQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggagtaatgatacaatattttgaatggaatcttcctgatgatgggaaacat
tgggaaagactgaaaaatgatgcaaaacatttaagtgaaataggagtttctgcagtatgg
attccacctgcatataaaggaacatcttcaatggatgtaggatatggggcatatgattta
tgggatttaggagaatttgatcagaagggtagcgtaagaacgaaatatggtacaaaacag
gaacttacagaagcaattgatgaacttcataaatacggtataaatgtctatcttgatgtt
gtattgaatcacaaggcaggggcagatgaaacagaaagatttatggtgatagaagtagct
tctgacaacagaaatgaagaagtgacggaaccttatgaaattgaaggatggacaaaattt
acatttcctggaagaaacgacagatattctgcttttaaatggaactataatctttttaca
ggagtagattttaataatgagaatcagaaaacggctatttataaaatagtgggagaaaac
aaggactgggctgaagaagtggatggggaaatgggaaattatgactatcttatgaatgca
gatgtgaactatgcccatcctgaagtcagaaaggaagtaataagctggggaaaatgggta
gtgaatgaactgaaactggacggattcagaatggatgcggtaaaacatataagtgaagga
tttataaaggaatttcttgatgaagtcagaaatgtttatggacaggatttctattctgta
ggagaatattggaaagatgaccttgaaacattaaaggaatatctggaaagcttggaatat
acaacagatttatttgatgtgggactgcattttaattttcatgaagcatcagtaagagga
aaggaatttgatcttagaacaatttttgataatacaatactgatgtcagattcaatgcag
gcagtttcttttgttgataatcacgactcgcagaagggaagtgcactggaatcccagata
gaaagctggttcaagccacatgcctatgcaataatacttctggcagaaagaggttatcct
tgcctgttctatggcgattattatggggtaggtggtcaggagagtgaacacagatggata
atagatcagctgctttatgtaagaaaaaattatgcctatggtggagaaattgattacttt
gataatcctaatattataggaatttacagaacaggaagggaaaatgaactgaatacagga
tgtatagccgtcctgtcaaataatgaggaaggggaaatactgatagaagcaggacagaac
cgtacaggacaggtatggaaagaagttacaggaagcggatttgaaaatgttgtgatagat
gataacggttttgctgcatttaaagtcagagcaggaaaaatttcggtctggattcctgat
gaacagtaa

DBGET integrated database retrieval system