KEGG   Leptotrichia sp. oral taxon 212: AMK43_10765
Entry
AMK43_10765       CDS       T04044                                 

Definition
(GenBank) hypothetical protein
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
leo  Leptotrichia sp. oral taxon 212
Pathway
leo00040  Pentose and glucuronate interconversions
leo00053  Ascorbate and aldarate metabolism
leo01100  Metabolic pathways
leo01120  Microbial metabolism in diverse environments
Module
leo_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:leo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMK43_10765
   00053 Ascorbate and aldarate metabolism
    AMK43_10765
Enzymes [BR:leo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     AMK43_10765
SSDB
Motif
Pfam: AP_endonuc_2 Glyco_hydro_97 DUF3798 DUF4862
Other DBs
NCBI-ProteinID: ALA96422
UniProt: A0A0K2JDC5
LinkDB
Position
complement(2307547..2308422)
AA seq 291 aa
MKDLNKLNLGIYEKALPKDIDWIERIRLVKECRYDFVEISVDETDERLARLDWSDEEINR
IHAELVNTGVRIPSMCFSGHRRFPMGSMDEKTREKAMELMQKAIIFADKMGIRTIQMAGY
DVYYEDGSEQTKKYFTENLKKAVEWASSYNITLSIEIMDHPFINSITKYMEYAEIIKSPW
LKVYPDVGNLTAWPENDTLKELELGIKNGEITGIHLKDTLAVTDSFPGKFKEVPFGEGCV
DFPKVFAKLKELNYKGPFLIEMWTEKSDNPIEEVKKAKEWMLGKMRKGGFI
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaaagatttaaataaacttaatttgggaatatatgaaaaggctcttcctaaggatatt
gactggattgaaagaatacgtcttgtaaaggaatgcagatatgattttgttgaaatatca
gtagatgaaactgatgaaagacttgcaaggcttgactggtctgatgaggaaattaacaga
atacatgctgagcttgtaaatacaggagtcagaattccatcaatgtgttttagcggacat
agaagatttccaatgggaagcatggatgaaaaaacgagagaaaaagcaatggaattaatg
cagaaagctataatttttgctgataagatgggaatcagaacaatccagatggcaggatat
gatgtgtattatgaagatggcagtgaacagacaaagaaatattttacagaaaatctgaaa
aaagctgtagaatgggcatcttcatataatattacactgtcgatagaaataatggaccat
ccttttataaactcaattacaaaatatatggaatatgcagaaataataaaatcgccatgg
ctgaaagtttatcctgatgtaggaaatcttactgcatggcctgaaaatgacacattaaag
gaactggagcttggaataaagaatggcgaaataacaggaattcacctgaaggatacactt
gcagtaacagacagttttccgggaaaatttaaggaagttccttttggagaaggatgtgtg
gattttccaaaagtatttgctaaactgaaggagctgaattataaaggtccgttccttata
gaaatgtggactgaaaaatctgacaatccaatcgaggaagtgaagaaggccaaggaatgg
atgcttggaaaaatgaggaaaggaggatttatctaa

DBGET integrated database retrieval system