KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_0671Help
Entry
Lepto7376_0671    CDS       T02361                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
lep00061  Fatty acid biosynthesis
lep00780  Biotin metabolism
lep01100  Metabolic pathways
lep01130  Biosynthesis of antibiotics
lep01212  Fatty acid metabolism
Module
lep_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Lepto7376_0671
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Lepto7376_0671
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Lepto7376_0671
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lep01004]
    Lepto7376_0671
Enzymes [BR:lep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Lepto7376_0671
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Lepto7376_0671
Lipid biosynthesis proteins [BR:lep01004]
 Fatty acid synthase
  Component type
   Lepto7376_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AFY37075
UniProt: K9PUD4
LinkDB All DBs
Position
complement(744833..745609)
Genome map
AA seq 258 aa AA seqDB search
MLDLTGKNALVTGIANNKSIAWGIAQQLHAAGANIGVTYLPDDKGRFEKKVGKLVEPLNP
SLFLPCNVQDDEQVDQVFEAVKKDWGKLDILIHCLAFAHREDLTGQFSDTSRDGFQTALG
ISSYSLTRLARGAKDVMTDGGAIVTMTYLGGVKVIPNYNVMGVAKSALEMSVRYLAADLG
PSNIRVNGISAGPIRTLASSAVGGILDMIHHVEATAPLRRTVTQTEVGNTAAFLCSDLSS
GITGQIVYVDSGYEIMGM
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatttaaccggaaaaaatgcccttgtcacagggattgcaaacaataaatccatt
gcgtggggtatcgctcaacagctccatgctgcgggcgcaaacatcggtgtcacttaccta
cccgatgataaaggtcgttttgagaagaaagtcggcaagttggtcgagcctctcaatcct
tctttgttccttccttgtaatgtgcaagatgatgaacaggttgatcaagtttttgaagcg
gttaaaaaggactggggcaagcttgatatcctcattcactgtttggcatttgcacaccgt
gaagatttaactggtcagtttagcgatacttcccgtgatggtttccaaacggctctcggt
atcagttcttactcactcactcgtttggcacgtggtgcaaaagacgtaatgacggatggt
ggagcaattgtcaccatgacctaccttggtggtgtaaaggttattccgaattacaacgtt
atgggtgtagcgaagtctgcgcttgagatgagtgttcgttatctcgcggcggatcttggc
cctagcaatattcgcgtcaatggtatttctgctggcccaattcgtactttagcttcttct
gctgttggtggcattctcgacatgattcaccacgtggaagcaactgcgcctttacgtcgt
acggtaactcagactgaagttggtaatacggcggcattcctctgtagtgatttgtctagt
ggcatcactggtcagattgtttatgtggattctggttacgaaattatgggtatgtaa

DBGET integrated database retrieval system