KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_2191Help
Entry
Lepto7376_2191    CDS       T02361                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
lep00010  Glycolysis / Gluconeogenesis
lep00020  Citrate cycle (TCA cycle)
lep00620  Pyruvate metabolism
lep01100  Metabolic pathways
lep01110  Biosynthesis of secondary metabolites
lep01120  Microbial metabolism in diverse environments
lep01130  Biosynthesis of antibiotics
lep01200  Carbon metabolism
Module
lep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lepto7376_2191
   00020 Citrate cycle (TCA cycle)
    Lepto7376_2191
   00620 Pyruvate metabolism
    Lepto7376_2191
Enzymes [BR:lep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lepto7376_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Motif
Other DBs
NCBI-ProteinID: AFY38482
UniProt: K9Q148
LinkDB All DBs
Position
complement(2472106..2473428)
Genome map
AA seq 440 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVAKGETVVVVESDKADMDVESFNEGFLAAIV
VEAGDEAPVGSAIALIAETEAEIEEAKQKAAALKNGAGSTPAPAAAPAPVAAPPPAPAPV
AAPAPVAASAPAPVVNEGRIVASPRAKKLAKQFSVDLKAVAGSGPHGRIIAQDVEAAAGK
APTAPAATATTTAAIASAPTPAAKAVPAPAPAASVTPGEVVPLNTLQQAVVRNMNASLEV
PTFHVSYDIATDKLDALYKQIKSKGVTMTGLLAKAVAVTLQKHPVVNASFGDNAIKYSNG
INIAVAVAMPDGGLITPVLQGADQMDIYSLSRKWKDLVSRARSKQLQPDEYSTGTFTLSN
LGMFGVSSFDAILPPGTGSILAIGGAQPKVVATADGLFGVKKSMTVNITCDHRVIYGADA
AAFLKDFADLIENNTHSLTL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatattttcatgcccgccctcagctccacgatgaccgaaggaaagatcgtc
tcttggactaagtcaccgggcgataaagttgctaaaggtgaaaccgttgtcgtggtggaa
tctgataaggctgatatggatgtggagtcttttaatgaaggattcctcgcagcaattgtt
gttgaagctggtgatgaagcgcctgttggttcggcgatcgccctgattgcagaaaccgag
gcagaaatcgaagaagcaaagcaaaaagcggcagccttaaaaaatggtgctggtagtact
ccggctcccgcagcagctccggctccagtcgcagctccaccccccgctcctgcacctgtt
gcagctcctgctccagtggcagcatcagcacctgcgcctgtggtaaatgaaggcagaatt
gttgcttctcccagagcaaagaagcttgcaaaacaatttagtgttgaccttaaggctgtt
gctggtagtggccctcacggtcggattattgctcaggacgttgaagcggcggcgggtaaa
gctcccactgctccagcggcaactgcaacaaccactgcggcgatcgcctctgcacctact
cctgccgcaaaagcagttccggcaccggcacctgcggcatccgttactcccggcgaagtt
gttcccctcaatactcttcagcaggcagtcgttcgcaacatgaacgcaagtctcgaagtt
ccaactttccacgtttcctacgacatcgcaactgacaagctcgatgcactctacaagcaa
attaagagcaagggcgtaactatgactggcctcctcgcgaaggctgtcgctgttactctc
cagaagcatcccgttgtgaatgcaagttttggtgataatgccatcaaatacagcaatggc
atcaatatcgcagtagctgtggcaatgcccgatggcggtttgattacccctgtgctccaa
ggcgctgatcaaatggatatttattctctatctcgcaagtggaaagatctcgtatcccgc
gcccgctcgaagcaactccagcctgatgagtacagcactggcacatttactctttctaac
ctcgggatgtttggtgtaagtagcttcgatgcaattttgcctccgggaactggttctatc
cttgcgattggcggagcacagcctaaggtggttgcgacggcagatggtctattcggcgta
aagaagtccatgacagtgaatatcacctgtgaccaccgcgttatttacggtgcagatgct
gcggcattcctgaaggactttgcagacctcatcgagaacaatactcactctctaacgctc
taa

DBGET integrated database retrieval system